BioLiP

>protein
AVLTGVATDKSEAKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNVFSVEDGTTDITFTCPRSDGRRAMEILKKLQVQ
GNWTNVLYDDQVGKVSLVGAGMKSHPGVTAEFMEALRDVNVNIELISTSEIRISVLIREDDLDAAARALHEQFQL

The query sequence (length=155) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3aaw:C	392	155	0.9935	0.3929	0.9935	2.24e-108	3aaw:A, 3aaw:B, 3aaw:D, 3ab2:A, 3ab2:B, 3ab2:C, 3ab2:D, 3ab2:E, 3ab2:F, 3ab2:G, 3ab2:H, 3ab2:I, 3ab2:J, 3ab2:K, 3ab2:L, 3ab2:M, 3ab2:N, 3ab2:O, 3ab2:P, 3ab4:B, 3ab4:D, 3ab4:F, 3ab4:H, 3ab4:J, 3ab4:K, 3ab4:L, 3ab4:M, 3ab4:N, 3ab4:P, 2dtj:A, 2dtj:B
2	3ab4:A	370	155	0.9871	0.4135	0.9871	4.66e-107	3ab4:C, 3ab4:E, 3ab4:G, 3ab4:I, 3ab4:O
3	4go7:X	165	154	0.6516	0.6121	0.6558	1.04e-65	3s1t:A, 3s1t:B
4	2re1:A	148	153	0.4516	0.4730	0.4575	4.94e-42
5	5yei:C	397	154	0.4323	0.1688	0.4351	3.24e-38	5yei:D, 5yei:B, 5yei:A, 5yei:F, 5yei:E, 5yei:H, 5yei:G
6	2dt9:A	153	152	0.3871	0.3922	0.3947	1.30e-32	2dt9:B
7	3l76:A	585	156	0.4000	0.1060	0.3974	4.76e-29	3l76:B
8	3l76:A	585	157	0.3548	0.0940	0.3503	1.92e-23	3l76:B
9	3c1m:C	468	165	0.3097	0.1026	0.2909	4.15e-14	3c1m:A, 3c1m:B, 3c1m:D, 3c1n:A, 3c1n:B, 3c1n:C, 3c1n:D, 3c20:A, 3c20:B, 2hmf:A, 2hmf:B, 2hmf:C, 2hmf:D
10	3tvi:E	439	85	0.1484	0.0524	0.2706	4.84e-04	3tvi:A, 3tvi:B, 3tvi:C, 3tvi:D, 3tvi:G, 3tvi:H, 3tvi:I, 3tvi:L
11	5i35:A	384	47	0.0968	0.0391	0.3191	0.096	7udp:A, 7udq:A, 7udq:B
12	2cdq:A	470	134	0.2194	0.0723	0.2537	1.5	2cdq:B
13	8t0q:A	257	28	0.0710	0.0428	0.3929	1.8	8t0q:B, 8t0v:B
14	1jxz:B	269	50	0.1161	0.0669	0.3600	2.4	1jxz:A, 1jxz:C, 1nzy:A, 1nzy:B, 1nzy:C

[Back]