AVLNEHISKAIATIGHFDLLTINDAGMPIPNDHRRIDLAVTKNLPRFIDVLATVLEEMEIQKIYLAEEIKEHNPTQLQQI
KQLISSEIEIIFIPHEEMKSNLAHPLNKGNIRTGETTPYSNIALESNVT
The query sequence (length=129) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3p13:A | 130 | 129 | 1.0000 | 0.9923 | 1.0000 | 1.84e-91 | 3p13:B, 3p13:C, 3p13:D |
2 | 1ogd:A | 131 | 128 | 0.4109 | 0.4046 | 0.4141 | 7.89e-27 | 1ogd:B, 1ogd:C, 1ogd:D, 1ogd:E, 1oge:A, 1oge:B, 1oge:C, 1oge:D, 1oge:E |
3 | 1mpy:A | 307 | 67 | 0.1628 | 0.0684 | 0.3134 | 0.21 | 1mpy:B, 1mpy:C, 1mpy:D |
4 | 4a34:I | 142 | 129 | 0.2171 | 0.1972 | 0.2171 | 0.27 | 4a34:A, 4a34:B, 4a34:C, 4a34:D, 4a34:E, 4a34:F, 4a34:G, 4a34:H, 4a34:J, 4a34:K, 4a34:O, 4a34:L, 4a34:M, 4a34:N, 4a34:P, 4a34:Q, 4a34:R, 4a34:S, 4a34:T |
5 | 5foe:B | 435 | 62 | 0.1240 | 0.0368 | 0.2581 | 0.64 | 5foe:A |
6 | 4mif:B | 581 | 34 | 0.0775 | 0.0172 | 0.2941 | 6.0 | 4mif:A, 4mif:C, 4mif:D, 4mig:A, 4mig:B, 4mig:C, 4mig:D, 4mih:A, 4mih:B, 4mih:C, 4mih:D, 4mih:E, 4mih:F, 4mih:G, 4mih:H |