AVLFADANQRGVHKHIFESDADVGADIAFNATPRSMVVLSGVWRLYREPNFQSPYEAEFGPGIYPSIADYGINVIGSMKR
IS
The query sequence (length=82) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5ht7:A | 82 | 82 | 1.0000 | 1.0000 | 1.0000 | 2.53e-57 | 5ht7:B, 5ht7:C |
2 | 2k1w:A | 85 | 79 | 0.3293 | 0.3176 | 0.3418 | 5.18e-04 | 5ht9:A, 5ht9:B, 3hz2:A, 3hz2:B, 3hz2:C, 3hz2:D |
3 | 2bv2:A | 83 | 72 | 0.2561 | 0.2530 | 0.2917 | 0.004 | 2bv2:B |
4 | 4iau:A | 161 | 60 | 0.2195 | 0.1118 | 0.3000 | 0.072 | |
5 | 7ev8:A | 328 | 24 | 0.1220 | 0.0305 | 0.4167 | 0.66 | |
6 | 4zpj:A | 371 | 59 | 0.2195 | 0.0485 | 0.3051 | 0.96 | |
7 | 6m7d:A | 412 | 24 | 0.1098 | 0.0218 | 0.3750 | 1.7 | |
8 | 5f6d:A | 156 | 43 | 0.1829 | 0.0962 | 0.3488 | 2.6 | 5f6u:A, 5f6v:A, 5f6w:A, 5f6x:A, 5f6y:A, 6syf:A, 6syf:B, 6syf:C, 6syf:D |
9 | 6zrd:A | 411 | 53 | 0.2073 | 0.0414 | 0.3208 | 4.9 | 7m40:A, 4pby:B, 4pc0:A, 4pc0:B, 5xwr:A, 2yba:A |
10 | 5ggi:B | 551 | 32 | 0.1341 | 0.0200 | 0.3438 | 7.3 | 5ggi:A, 5ggj:A, 5ggj:B, 5ggk:A, 5ggk:B, 5ggl:A, 5ggl:B, 5ggn:A, 5ggn:B, 5ggo:A, 5ggo:B, 5ggp:A, 5ggp:B, 5xfc:A, 5xfc:B |