AVKYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELLKTFIIGELHPD
DR
The query sequence (length=82) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 1hko:A | 104 | 82 | 0.9878 | 0.7788 | 0.9878 | 5.66e-57 | 1aqa:A, 1cyo:A, 1ehb:A, 1es1:A, 1f03:A, 1f04:A, 1i5u:A, 1ib7:A, 1j0q:A, 1jex:A, 1lqx:A, 1lr6:A, 1m20:A, 1m2i:A, 1m2m:A, 1m59:A, 1nx7:A, 1sh4:A, 1u9m:A, 1u9m:B, 1u9m:C, 1u9m:D, 1u9m:E, 1u9m:F, 1u9u:A, 3x32:A, 3x33:A, 3x34:A, 3x35:A |
| 2 | 2i96:A | 108 | 82 | 0.9512 | 0.7222 | 0.9512 | 8.48e-55 | 4hin:A, 4hin:B, 4hin:C, 4hin:D, 2m33:A |
| 3 | 1aw3:A | 94 | 81 | 0.9146 | 0.7979 | 0.9259 | 2.94e-52 | 1axx:A, 2axx:A, 1b5a:A, 1b5b:A, 1bfx:A, 1blv:A, 1do9:A, 1mny:A |
| 4 | 3ozz:B | 82 | 82 | 0.8659 | 0.8659 | 0.8659 | 2.24e-51 | |
| 5 | 2i89:A | 90 | 81 | 0.7073 | 0.6444 | 0.7160 | 1.41e-41 | 2i89:B, 2i89:C, 2i89:D, 1icc:A, 1icc:B, 1icc:D, 1lj0:A, 1lj0:B, 1lj0:C, 1lj0:D, 3mus:B |
| 6 | 1awp:A | 86 | 81 | 0.6220 | 0.5930 | 0.6296 | 5.22e-37 | 1awp:B, 1b5m:A, 1eue:A, 1eue:B, 4hil:A, 4hil:B, 1icc:C, 3mus:A |
| 7 | 3ner:B | 91 | 81 | 0.6341 | 0.5714 | 0.6420 | 2.54e-36 | 3ner:A |
| 8 | 2ibj:A | 86 | 81 | 0.5976 | 0.5698 | 0.6049 | 7.68e-33 | |
| 9 | 4b8n:B | 90 | 72 | 0.3902 | 0.3556 | 0.4444 | 1.90e-13 | 4b8n:A, 4b8n:C, 4b8n:D |
| 10 | 3lf5:A | 87 | 72 | 0.3171 | 0.2989 | 0.3611 | 3.19e-13 | 3lf5:B |
| 11 | 1cxy:A | 81 | 80 | 0.3293 | 0.3333 | 0.3375 | 4.70e-13 | |
| 12 | 1x3x:A | 82 | 79 | 0.3659 | 0.3659 | 0.3797 | 2.13e-11 | 1x3x:B |
| 13 | 1kbi:A | 504 | 49 | 0.2805 | 0.0456 | 0.4694 | 2.16e-11 | 1fcb:A, 1fcb:B, 1kbi:B, 1kbj:A, 1kbj:B, 3ks0:A, 3ks0:B, 1lco:A, 1lco:B, 1ldc:A, 1ltd:A, 1ltd:B, 2oz0:A, 2oz0:B, 1qcw:A, 1qcw:B, 1sze:A, 1sze:B, 1szf:A, 1szf:B, 1szg:A, 1szg:B |
| 14 | 8tgb:A | 108 | 76 | 0.2927 | 0.2222 | 0.3158 | 2.78e-11 | 8tgb:B |
| 15 | 7bwh:A | 88 | 84 | 0.3171 | 0.2955 | 0.3095 | 5.98e-11 | |
| 16 | 1sox:A | 463 | 81 | 0.3659 | 0.0648 | 0.3704 | 5.04e-08 | 2a9a:A, 2a9a:B, 2a9b:A, 2a9c:A, 2a9c:B, 2a9d:A, 2a9d:B, 3hbp:A, 3hbq:A, 1sox:B |
| 17 | 1mj4:A | 79 | 73 | 0.3049 | 0.3165 | 0.3425 | 3.85e-07 | |
| 18 | 1k6m:A | 432 | 48 | 0.1463 | 0.0278 | 0.2500 | 1.3 | 1c7z:A, 1c7z:B, 1c80:A, 1c80:B, 1c81:A, 1fbt:A, 1fbt:B, 1k6m:B, 1tip:A, 1tip:B |
| 19 | 4jz6:A | 484 | 55 | 0.2195 | 0.0372 | 0.3273 | 3.2 | |
| 20 | 5lvf:A | 142 | 24 | 0.1341 | 0.0775 | 0.4583 | 4.0 | 2l0i:A, 5m9d:A |
| 21 | 2d2c:D | 168 | 24 | 0.1341 | 0.0655 | 0.4583 | 4.3 | 2d2c:Q, 2e74:D, 2e75:D, 2e76:D, 4h0l:D, 4h13:D, 4i7z:D, 4pv1:D, 1vf5:D, 1vf5:Q |
| 22 | 3t58:B | 504 | 32 | 0.1220 | 0.0198 | 0.3125 | 7.6 | 4p2l:A, 4p2l:B, 3t58:A, 3t58:C, 3t58:D, 3t59:A, 3t59:B, 3t59:C, 3t59:D |
| 23 | 2axn:A | 451 | 50 | 0.1463 | 0.0266 | 0.2400 | 8.0 | 5ajv:B, 5ajw:A, 5ajx:A, 5ajy:A, 5ajz:A, 5ak0:A, 4d4j:A, 4d4k:A, 4d4l:A, 4d4m:A, 2dwo:A, 2dwp:A, 6etj:A, 6hvh:A, 6hvi:A, 6hvj:A, 2i1v:B, 6ibx:A, 6iby:A, 6ibz:A, 6ic0:A, 4ma4:A, 3qpu:A, 3qpv:A, 3qpw:A |
| 24 | 1p5j:A | 319 | 27 | 0.1341 | 0.0345 | 0.4074 | 8.2 | |
| 25 | 7unj:A | 218 | 17 | 0.0976 | 0.0367 | 0.4706 | 9.2 | 7unj:B |
umich.edu