AVKYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDHGHSTDARELSKTFIIGELHPD
DR
The query sequence (length=82) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 1hko:A | 104 | 82 | 0.9878 | 0.7788 | 0.9878 | 1.09e-56 | 1aqa:A, 1cyo:A, 1ehb:A, 1es1:A, 1f03:A, 1f04:A, 1i5u:A, 1ib7:A, 1j0q:A, 1jex:A, 1lqx:A, 1lr6:A, 1m20:A, 1m2i:A, 1m2m:A, 1m59:A, 1nx7:A, 1sh4:A, 1u9m:A, 1u9m:B, 1u9m:C, 1u9m:D, 1u9m:E, 1u9m:F, 1u9u:A, 3x32:A, 3x33:A, 3x34:A, 3x35:A |
| 2 | 2i96:A | 108 | 82 | 0.9512 | 0.7222 | 0.9512 | 2.68e-54 | 4hin:A, 4hin:B, 4hin:C, 4hin:D, 2m33:A |
| 3 | 1aw3:A | 94 | 81 | 0.9146 | 0.7979 | 0.9259 | 5.73e-52 | 1axx:A, 2axx:A, 1b5a:A, 1b5b:A, 1bfx:A, 1blv:A, 1do9:A, 1mny:A |
| 4 | 3ozz:B | 82 | 82 | 0.8415 | 0.8415 | 0.8415 | 3.91e-49 | |
| 5 | 2i89:A | 90 | 81 | 0.7073 | 0.6444 | 0.7160 | 3.71e-41 | 2i89:B, 2i89:C, 2i89:D, 1icc:A, 1icc:B, 1icc:D, 1lj0:A, 1lj0:B, 1lj0:C, 1lj0:D, 3mus:B |
| 6 | 1awp:A | 86 | 81 | 0.6098 | 0.5814 | 0.6173 | 2.06e-35 | 1awp:B, 1b5m:A, 1eue:A, 1eue:B, 4hil:A, 4hil:B, 1icc:C, 3mus:A |
| 7 | 3ner:B | 91 | 81 | 0.6098 | 0.5495 | 0.6173 | 3.49e-34 | 3ner:A |
| 8 | 2ibj:A | 86 | 81 | 0.5854 | 0.5581 | 0.5926 | 5.29e-31 | |
| 9 | 4b8n:B | 90 | 73 | 0.3659 | 0.3333 | 0.4110 | 1.22e-13 | 4b8n:A, 4b8n:C, 4b8n:D |
| 10 | 1cxy:A | 81 | 80 | 0.3171 | 0.3210 | 0.3250 | 3.27e-12 | |
| 11 | 3lf5:A | 87 | 72 | 0.2927 | 0.2759 | 0.3333 | 4.04e-11 | 3lf5:B |
| 12 | 1kbi:A | 504 | 49 | 0.2805 | 0.0456 | 0.4694 | 6.33e-11 | 1fcb:A, 1fcb:B, 1kbi:B, 1kbj:A, 1kbj:B, 3ks0:A, 3ks0:B, 1lco:A, 1lco:B, 1ldc:A, 1ltd:A, 1ltd:B, 2oz0:A, 2oz0:B, 1qcw:A, 1qcw:B, 1sze:A, 1sze:B, 1szf:A, 1szf:B, 1szg:A, 1szg:B |
| 13 | 8tgb:A | 108 | 79 | 0.2805 | 0.2130 | 0.2911 | 6.82e-11 | 8tgb:B |
| 14 | 1x3x:A | 82 | 76 | 0.3659 | 0.3659 | 0.3947 | 1.13e-10 | 1x3x:B |
| 15 | 7bwh:A | 88 | 84 | 0.3049 | 0.2841 | 0.2976 | 3.73e-09 | |
| 16 | 1sox:A | 463 | 82 | 0.3659 | 0.0648 | 0.3659 | 3.39e-07 | 2a9a:A, 2a9a:B, 2a9b:A, 2a9c:A, 2a9c:B, 2a9d:A, 2a9d:B, 3hbp:A, 3hbq:A, 1sox:B |
| 17 | 1mj4:A | 79 | 73 | 0.2805 | 0.2911 | 0.3151 | 5.48e-06 | |
| 18 | 1k6m:A | 432 | 48 | 0.1463 | 0.0278 | 0.2500 | 1.5 | 1c7z:A, 1c7z:B, 1c80:A, 1c80:B, 1c81:A, 1fbt:A, 1fbt:B, 1k6m:B, 1tip:A, 1tip:B |
| 19 | 8jzd:A | 166 | 38 | 0.1829 | 0.0904 | 0.3947 | 2.5 | 8jzd:C |
| 20 | 5lvf:A | 142 | 24 | 0.1341 | 0.0775 | 0.4583 | 4.2 | 2l0i:A, 5m9d:A |
| 21 | 2d2c:D | 168 | 24 | 0.1341 | 0.0655 | 0.4583 | 4.3 | 2d2c:Q, 2e74:D, 2e75:D, 2e76:D, 4h0l:D, 4h13:D, 4i7z:D, 4pv1:D, 1vf5:D, 1vf5:Q |
| 22 | 3t58:B | 504 | 32 | 0.1220 | 0.0198 | 0.3125 | 7.6 | 4p2l:A, 4p2l:B, 3t58:A, 3t58:C, 3t58:D, 3t59:A, 3t59:B, 3t59:C, 3t59:D |
| 23 | 1p5j:A | 319 | 27 | 0.1341 | 0.0345 | 0.4074 | 8.2 | |
| 24 | 2axn:A | 451 | 50 | 0.1463 | 0.0266 | 0.2400 | 8.5 | 5ajv:B, 5ajw:A, 5ajx:A, 5ajy:A, 5ajz:A, 5ak0:A, 4d4j:A, 4d4k:A, 4d4l:A, 4d4m:A, 2dwo:A, 2dwp:A, 6etj:A, 6hvh:A, 6hvi:A, 6hvj:A, 2i1v:B, 6ibx:A, 6iby:A, 6ibz:A, 6ic0:A, 4ma4:A, 3qpu:A, 3qpv:A, 3qpw:A |
| 25 | 2vbc:A | 600 | 19 | 0.1220 | 0.0167 | 0.5263 | 9.2 | 2jlr:A, 2jls:A, 2jlu:A, 2jlu:B, 2jlv:A, 2jlv:B, 2jlw:A, 2jlw:B, 2jlx:A, 2jlx:B, 2jly:A, 2jly:B, 2jlz:A, 2jlz:B, 2whx:A, 2wzq:A, 5xc6:A, 5xc6:B, 5yvj:B |
| 26 | 6e0a:B | 262 | 72 | 0.2317 | 0.0725 | 0.2639 | 9.5 | 6e0a:A |
umich.edu