AVKNCSHLECFYNSRANVSCMWSHLNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINV
VCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQ
RQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPA
The query sequence (length=206) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6dg5:B | 206 | 206 | 1.0000 | 1.0000 | 1.0000 | 1.58e-154 | |
2 | 2erj:B | 204 | 202 | 0.5777 | 0.5833 | 0.5891 | 4.53e-82 | 2erj:F, 5m5e:B, 7s2s:B, 7s2s:D |
3 | 2gys:B | 406 | 103 | 0.1602 | 0.0813 | 0.3204 | 4.09e-05 | |
4 | 2gys:B | 406 | 95 | 0.1456 | 0.0739 | 0.3158 | 0.002 | |
5 | 4nzd:A | 210 | 212 | 0.2233 | 0.2190 | 0.2170 | 2.52e-04 | 4nzd:B, 4nzd:C, 3tgx:A, 3tgx:C, 3tgx:E, 3tgx:G, 3tgx:I, 3tgx:K, 3tgx:O, 3tgx:M |
6 | 6h41:A | 309 | 162 | 0.1942 | 0.1294 | 0.2469 | 0.048 | 3qt2:B |
7 | 4rtb:A | 429 | 90 | 0.0971 | 0.0466 | 0.2222 | 0.44 | |
8 | 7t6b:R | 264 | 32 | 0.0631 | 0.0492 | 0.4062 | 0.49 | |
9 | 1civ:A | 374 | 39 | 0.0680 | 0.0374 | 0.3590 | 0.78 | |
10 | 4r3a:A | 318 | 26 | 0.0534 | 0.0346 | 0.4231 | 3.2 | 4r38:A, 4r38:B, 4r38:C, 4r38:D, 4r39:A, 4r39:B, 4r39:C, 4r39:D |
11 | 4r3a:B | 278 | 26 | 0.0534 | 0.0396 | 0.4231 | 4.0 | |
12 | 7b5f:G | 133 | 75 | 0.0922 | 0.1429 | 0.2533 | 7.8 |