BioLiP

>protein
AVINHDAVPVWPQPEPADATQALAVRFKPQLDVVNGCQPYPAVDPQGNTSGGLKPSAAACRDMSKAQVYSRSGTYNGYYA
IMYSWYMPKDSIGHRHDWENVVVWLDNAASANIVALSASAHSGYKKSFPADKSYLDGITAKISYKSTWPLDHELGFTTSA
GKQQPLIQWEQMTQAARDALESTDFGNANVPFKSNFQDKLVKAFFQ

The query sequence (length=206) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5no9:B	212	212	1.0000	0.9717	0.9717	1.60e-151	3gnz:P, 5nnw:A, 5nnw:B, 5nnw:C, 5nnw:D, 5no9:A, 5no9:C, 5no9:D, 6qbd:A, 6qbd:B
2	3st1:A	212	204	0.4078	0.3962	0.4118	1.11e-42
3	6hq8:A	1138	41	0.0680	0.0123	0.3415	0.55	6hq8:B
4	7arc:F	430	54	0.0825	0.0395	0.3148	2.5	7ard:F
5	7trc:K	330	45	0.0777	0.0485	0.3556	3.2	7bgb:K
6	3jqp:D	269	54	0.0777	0.0595	0.2963	6.1	3jqp:A, 3jqp:B, 3jqp:C, 3jqp:E, 3jqp:F, 3jqq:A, 3jqq:B, 3jqq:C, 3jqq:D, 3jqq:E, 3jqq:F, 3jqr:A, 2ok7:A, 2ok7:B, 2ok7:C, 2ok7:D, 2ok7:E, 2ok7:F, 2ok8:A, 2ok8:B, 2ok8:C, 2ok8:D
7	7pfp:A	563	73	0.0777	0.0284	0.2192	6.1	7pfp:C, 7q3n:U
8	4wrn:A	693	73	0.0777	0.0231	0.2192	6.7	7pfp:B
9	4wrn:B	663	73	0.0777	0.0241	0.2192	7.2
10	7nvo:B	282	38	0.0631	0.0461	0.3421	8.6	7nvo:b
11	7ttn:E	528	38	0.0631	0.0246	0.3421	9.6	8i1u:B, 8i1u:J, 7nvl:B, 7nvl:b, 7nvm:B, 7nvm:b, 7nvn:B, 7nvn:b, 8sfe:b, 8sfe:B, 8sff:B, 8sff:b, 8sg8:B, 8sg8:b, 8sg9:B, 8sg9:b, 8sgc:B, 8sgc:b, 8sgl:B, 8sgl:b, 8sgq:B, 8sgq:b, 8sh9:B, 8sh9:b, 8sha:B, 8sha:b, 8shd:B, 8shd:b, 8she:B, 8she:b, 8shf:B, 8shf:b, 8shg:B, 8shg:b, 8shl:B, 8shl:b, 8shn:B, 8shn:b, 8sho:B, 8sho:b, 8shp:B, 8shp:b, 8shq:B, 8shq:b, 8sht:B, 8sht:b, 7trg:E, 7ttt:E, 7tub:E, 7x0s:B, 7x0s:L, 7x0v:B, 7x0v:L, 7x3j:B, 7x3j:b, 7x3u:b, 7x3u:B

[Back]