AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGT
The query sequence (length=70) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2b97:A | 70 | 70 | 1.0000 | 1.0000 | 1.0000 | 3.39e-45 | 3qqt:A, 3qqt:B, 1r2m:A |
2 | 2fz6:A | 72 | 67 | 0.6286 | 0.6111 | 0.6567 | 1.05e-24 | 2gvm:B |
3 | 3viu:A | 703 | 26 | 0.1429 | 0.0142 | 0.3846 | 5.7 | |
4 | 4i5q:A | 220 | 39 | 0.2000 | 0.0636 | 0.3590 | 9.8 | |
5 | 1sdd:A | 268 | 23 | 0.1286 | 0.0336 | 0.3913 | 9.9 |