ATVFKLGLFKSLFLCSFHDITRLFKNDKTTNQQWVLAVFGLAEVFFEASFELLKKQCSFLQMQKRSHEGGTCAVYLICFN
TAKSRETVRNLMANMLNVREECLMLQPPKIRGLSAALFWFKSSLSPATLKHGALPEWIRAQTTLN
The query sequence (length=145) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7apd:G | 152 | 145 | 1.0000 | 0.9539 | 1.0000 | 1.62e-106 | 7apd:H, 1ksx:A, 1ksx:B, 1ksx:E, 1ksx:F, 1ksx:I, 1ksx:J, 1ksx:M, 1ksx:N, 1ksy:A, 1ksy:B, 1ksy:C |
2 | 3srj:A | 298 | 73 | 0.1241 | 0.0604 | 0.2466 | 1.7 | 3sri:A, 3srj:B, 4z09:A, 4z0d:A, 4z0e:A, 4z0f:A |
3 | 7qv7:A | 174 | 31 | 0.0759 | 0.0632 | 0.3548 | 4.5 | 7qv7:G |
4 | 4epp:A | 439 | 40 | 0.0828 | 0.0273 | 0.3000 | 7.9 | 4epp:B, 4epq:A, 4l2h:A |