ATTLYLTRHGETKWNVERRMQGWQDSPLTEKGRQDAMRLGKRLEAVELAAIYTSTSGRALETAEIVRGGRLIPIYQDERL
REIHLGDWEGKTHDEIRQMDPIAFDHFWQAPHLYAPQRGERFCDVQQRALEAVQSIVDRHEGETVLIVTHGVVLKTLMAA
FKDTPLDHLWSPPYMYGTSVTIIEVDGGTFHVAVEGDVSHIEEVKEV
The query sequence (length=207) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1h2e:A | 207 | 207 | 1.0000 | 1.0000 | 1.0000 | 2.45e-154 | 1h2f:A |
2 | 4ij6:A | 207 | 170 | 0.2415 | 0.2415 | 0.2941 | 4.43e-20 | 4ij6:B |
3 | 1k6m:A | 432 | 205 | 0.2995 | 0.1435 | 0.3024 | 1.26e-17 | 1c7z:A, 1c7z:B, 1c80:A, 1c80:B, 1c81:A, 1fbt:A, 1fbt:B, 1k6m:B, 1tip:A, 1tip:B |
4 | 2axn:A | 451 | 204 | 0.3140 | 0.1441 | 0.3186 | 1.66e-17 | 5ajv:B, 5ajw:A, 5ajx:A, 5ajy:A, 5ajz:A, 5ak0:A, 4d4j:A, 4d4k:A, 4d4l:A, 4d4m:A, 2dwo:A, 2dwp:A, 6etj:A, 6hvh:A, 6hvi:A, 6hvj:A, 2i1v:B, 6ibx:A, 6iby:A, 6ibz:A, 6ic0:A, 4ma4:A, 3qpu:A, 3qpv:A, 3qpw:A |
5 | 5htk:A | 425 | 205 | 0.3285 | 0.1600 | 0.3317 | 1.17e-16 | 5hr5:A, 5htk:B |
6 | 1bif:A | 432 | 196 | 0.2802 | 0.1343 | 0.2959 | 2.43e-16 | 2bif:A, 2bif:B |
7 | 1qhf:A | 240 | 187 | 0.2850 | 0.2458 | 0.3155 | 2.34e-15 | 1bq3:D, 1bq3:A, 1bq4:A, 5pgm:E, 1qhf:B |
8 | 4pza:B | 217 | 137 | 0.2464 | 0.2350 | 0.3723 | 2.69e-15 | 4pza:A, 4qih:A, 4qih:B |
9 | 5zr2:C | 198 | 156 | 0.2174 | 0.2273 | 0.2885 | 2.00e-13 | 6m1x:C, 6m1x:D, 5zr2:A, 5zr2:B, 5zr2:D |
10 | 7xb8:B | 249 | 192 | 0.2464 | 0.2048 | 0.2656 | 1.87e-10 | 6isn:C, 8it4:A, 8it4:B, 8it5:C, 8it6:C, 8it7:C, 8it8:C, 8itb:C, 8itc:C, 8itd:C, 7xb7:B, 7xb7:C, 7xb8:C, 7xb9:B, 7xb9:C, 5y2i:B, 5y2u:B, 5y2u:C, 5y35:C, 5y64:C, 5y65:C, 1yfk:A, 1yjx:B, 1yjx:C, 1yjx:D, 1yjx:E, 1yjx:G, 1yjx:I, 1yjx:J, 1yjx:K, 1yjx:L, 5zrm:C, 5zs8:C |
11 | 2h4z:A | 255 | 197 | 0.2464 | 0.2000 | 0.2589 | 3.74e-10 | 2f90:A, 2f90:B, 2h4z:B, 2hhj:A, 2hhj:B, 7n3r:B, 7n3s:A, 7n3s:B, 7thi:A, 7thi:B |
12 | 1e59:A | 239 | 189 | 0.2609 | 0.2259 | 0.2857 | 9.26e-10 | |
13 | 3gp5:A | 248 | 97 | 0.1691 | 0.1411 | 0.3608 | 3.44e-08 | 3fdz:A, 3gp3:A, 3gp3:B, 3gp3:C, 3gp3:D, 3gp5:B, 3gw8:A, 3gw8:B |
14 | 3lg2:A | 269 | 184 | 0.2271 | 0.1747 | 0.2554 | 1.10e-05 | 3lg2:B, 3lg2:C, 3lg2:D, 3ll4:A, 3ll4:B, 3oi7:A, 3oi7:B, 3oi7:C, 3oi7:D |
15 | 9emu:C | 227 | 96 | 0.1401 | 0.1278 | 0.3021 | 1.36e-05 | 9emu:A, 9emu:B, 9emu:D |
16 | 2b7y:A | 181 | 52 | 0.0628 | 0.0718 | 0.2500 | 0.44 | 2b7y:C |
17 | 3c7t:A | 259 | 152 | 0.1691 | 0.1351 | 0.2303 | 0.46 | 3c7t:B, 3c7t:C, 3c7t:D |
18 | 2dld:A | 337 | 69 | 0.0966 | 0.0593 | 0.2899 | 1.9 | 2dld:B |
19 | 4uy0:C | 333 | 19 | 0.0531 | 0.0330 | 0.5789 | 2.2 | |
20 | 8gdl:A | 355 | 23 | 0.0531 | 0.0310 | 0.4783 | 3.9 | 8gdl:B |
21 | 7mjc:A | 493 | 42 | 0.0628 | 0.0264 | 0.3095 | 5.3 | 7mjc:B, 7mjd:A, 7mjd:B, 7rad:A, 7rad:B |
22 | 4my0:C | 392 | 46 | 0.0918 | 0.0485 | 0.4130 | 6.3 | 4my0:A, 4my0:E, 4my0:B, 4my0:D, 4my0:F |
23 | 3ays:A | 357 | 35 | 0.0628 | 0.0364 | 0.3714 | 7.3 |