ATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGRRESVPPSIIMSSQKTEKKAVTPA
PPIKRWELSSDQPYL
The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7vb7:I | 97 | 95 | 0.9158 | 0.8969 | 0.9158 | 1.05e-61 | 5lnk:h, 6q9d:A7, 7vbn:I, 7vbz:I, 7vwj:I, 7vxp:I, 7vxu:I, 7vy8:I, 7vya:I, 7vyf:I, 7vyh:I, 7vyn:I, 7vz1:I, 5xtb:I |
2 | 3qg6:B | 209 | 37 | 0.1263 | 0.0574 | 0.3243 | 0.38 | 3qg6:H |
3 | 2bpa:1 | 426 | 30 | 0.1263 | 0.0282 | 0.4000 | 1.1 | |
4 | 1gff:1 | 417 | 30 | 0.1263 | 0.0288 | 0.4000 | 1.3 | |
5 | 1pp9:O | 424 | 19 | 0.1053 | 0.0236 | 0.5263 | 1.8 | 2a06:B, 4d6t:B, 4d6t:O, 4d6u:B, 4d6u:O, 7dgq:l, 7dgq:x, 7dgr:l, 7dgr:x, 7dgs:l, 7dgs:x, 6fo0:O, 6fo0:B, 6fo2:O, 6fo2:B, 1pp9:B, 1ppj:O, 1ppj:B, 6qbx:a2, 6qbx:a4, 6qc3:a2, 6qc3:a4, 7tz6:B, 7tz6:O |
6 | 8eju:B | 257 | 76 | 0.2526 | 0.0934 | 0.3158 | 2.7 | 8eju:A |
7 | 5fzo:A | 339 | 32 | 0.0947 | 0.0265 | 0.2812 | 3.6 | 5fzo:B, 2ypd:A, 2ypd:B |
8 | 1m06:F | 422 | 37 | 0.1368 | 0.0308 | 0.3514 | 5.0 | 1rb8:F |
9 | 7u0h:q | 189 | 42 | 0.1368 | 0.0688 | 0.3095 | 6.0 | |
10 | 2y1h:B | 265 | 43 | 0.1684 | 0.0604 | 0.3721 | 8.9 | 2y1h:A |