ATLFYTPGLVTKRSSHVRDSVDLKRIMIMVWLAVFPAMFWGMYNAGGQAIAALNHLYSGDQLAAIVAGNWHYWLTEMLGG
TMSSDAGWGSKMLLGATYFLPIYATVFIVGGFWEVLFCMVRKHEVNEGFFVTSILFALIVPPTLPLWQAALGITFGVVVA
KEVFGGTGRNFLNPALAGRAFLFFAYPAQISGDLVWTAADGYSGATALSQWAQGGAGALINNATGQTITWMDAFIGNIPG
SIGEVSTLALMIGAAFIVYMGIASWRIIGGVMIGMILLSTLFNVIGSDTNAMFNMPWHWHLVLGGFAFGMFFMATDPVSA
SFTNSGKWAYGILIGVMCVLIRVVNPAYPEGMMLAILFANLFAPLFDHVVVERNIKRRLARYGK
The query sequence (length=384) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8a1w:B | 412 | 384 | 1.0000 | 0.9320 | 1.0000 | 0.0 | 8a1t:B, 8a1u:B, 8a1v:B, 8a1x:B, 8a1y:B, 8acw:B, 8acy:B, 8ad0:B, 8evu:B, 8ew3:B, 7xk3:B, 7xk4:B, 7xk5:B, 7xk6:B, 7xk7:B |
2 | 7zc6:D | 304 | 267 | 0.2552 | 0.3224 | 0.3670 | 8.72e-31 | |
3 | 8ahx:D | 349 | 285 | 0.2161 | 0.2378 | 0.2912 | 3.05e-22 | 8rb8:D, 8rb9:D, 8rbm:D |
4 | 8rbq:D | 305 | 263 | 0.1849 | 0.2328 | 0.2700 | 2.61e-16 | |
5 | 8jze:l | 250 | 67 | 0.0625 | 0.0960 | 0.3582 | 1.4 | 8jzf:l |
6 | 3ai9:X | 211 | 66 | 0.0417 | 0.0758 | 0.2424 | 2.6 | 3aia:A, 3aia:B |