ATGGYVQQATGQASFTMYSGCGSPACGKAASGFTAAINQLAFGSAPGLGAGDACGRCFALTGNHDPYSPNYTGPFGQTIV
The query sequence (length=180) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # |
Hit |
Hit
length |
Aligned
length |
Identity
(normalized by query) |
Identity
(normalized by hit) |
Identity (normalized
by aligned length) |
E-value |
Homologs
to hit |
| 1 |
5kjq:A |
180 |
180 |
0.9944 |
0.9944 |
0.9944 |
1.80e-129 |
3x2g:A, 3x2h:A, 3x2i:A, 3x2k:A, 3x2l:A, 3x2m:A, 3x2p:A |
| 2 |
5xbx:A |
179 |
78 |
0.1500 |
0.1508 |
0.3462 |
3.81e-05 |
5xc4:A, 5xc8:A, 5xc9:A, 5xca:A |
| 3 |
7r7j:B |
574 |
45 |
0.1000 |
0.0314 |
0.4000 |
0.93 |
8h5y:B, 8h5y:A, 8h5z:B, 8h5z:A, 6jde:B, 6jde:A, 7r7j:A |
| 4 |
3qgu:A |
406 |
41 |
0.0667 |
0.0296 |
0.2927 |
3.9 |
|
| 5 |
8xme:A |
1176 |
42 |
0.0833 |
0.0128 |
0.3571 |
5.1 |
7eu0:A, 8xmb:A, 8xmc:A, 8xmd:A |
| 6 |
7eu1:A |
1065 |
42 |
0.0833 |
0.0141 |
0.3571 |
5.2 |
|
| 7 |
2y7h:B |
529 |
52 |
0.0778 |
0.0265 |
0.2692 |
8.1 |
2y7h:C |
| 8 |
7qep:D5 |
87 |
18 |
0.0500 |
0.1034 |
0.5000 |
8.3 |
|
| 9 |
1e9x:A |
449 |
106 |
0.1444 |
0.0579 |
0.2453 |
8.9 |
2bz9:A, 2bz9:B, 1ea1:A, 1h5z:A, 1u13:A, 2vku:A, 2w0b:A, 1x8v:A |
| 10 |
5j55:A |
480 |
27 |
0.0667 |
0.0250 |
0.4444 |
9.1 |
5j53:A, 5j54:A, 7qr6:A, 7qr6:B, 7qr6:C |
| 11 |
1n4p:B |
346 |
44 |
0.0944 |
0.0491 |
0.3864 |
9.6 |
1n4p:D, 1n4p:F, 1n4p:H, 1n4p:J, 1n4p:L, 1n4q:B, 1n4q:D, 1n4q:F, 1n4q:H, 1n4q:J, 1n4q:L, 1n4r:B, 1n4r:D, 1n4r:F, 1n4r:H, 1n4r:J, 1n4r:L, 1n4s:B, 1n4s:D, 1n4s:F, 1n4s:H, 1n4s:L, 1n4s:J, 8rdx:B, 8rdx:D, 8rdx:F, 8rdx:H, 8rdx:J, 8rdx:L, 1s64:B, 1s64:D, 1s64:F, 1s64:H, 1s64:J, 1s64:L, 1tnb:B, 1tnb:D, 1tnb:F, 1tnb:H, 1tnb:J, 1tnb:L, 1tno:B, 1tno:D, 1tno:F, 1tno:H, 1tno:J, 1tno:L, 1tnu:B, 1tnu:D, 1tnu:F, 1tnu:H, 1tnu:J, 1tnu:L, 1tny:B, 1tny:D, 1tny:F, 1tny:H, 1tny:J, 1tny:L, 1tnz:B, 1tnz:D, 1tnz:F, 1tnz:H, 1tnz:J, 1tnz:L |
| 12 |
4xdd:A |
582 |
46 |
0.0833 |
0.0258 |
0.3261 |
9.9 |
8aio:A, 8aio:B, 8aj6:A, 8aj6:B, 8aln:A, 8aln:B, 8ap2:A, 8ap2:B, 5byq:A, 5byq:B, 5byr:A, 5byr:B, 5bys:A, 5bys:B, 1c4a:A, 1c4c:A, 3c8y:A, 8cjy:A, 8cjy:B, 1feh:A, 6gly:A, 6gly:B, 6glz:A, 6glz:B, 6gm0:A, 6gm0:B, 6gm1:A, 6gm1:B, 6gm2:A, 6gm2:B, 6gm3:A, 6gm3:B, 6gm4:A, 6gm4:B, 6gm8:A, 6gm8:B, 6h63:A, 6h63:B, 5la3:A, 5la3:B, 6n59:A, 6n6p:A, 6nac:A, 5oef:A, 5oef:B, 8pvm:A, 8pvm:B, 7qhf:A, 7qhf:B, 8qm3:A, 8qm3:B, 4xdc:A, 4xdc:B, 4xdd:B, 6yf4:A, 6yf4:B |
umich.edu