ATFQTDADFLLVGDDTSRYEEVMKTFDTVEAVRKSDLDDRVYMVCLKQGSTFVLNGGIEELRLLTGDSTLEIQPMIVPT
The query sequence (length=79) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2gj2:A | 79 | 79 | 1.0000 | 1.0000 | 1.0000 | 1.88e-53 | 2gj2:D, 2gj2:B, 2gj2:C |
2 | 3qry:B | 426 | 59 | 0.2532 | 0.0469 | 0.3390 | 1.1 | 3qry:A, 3qsp:A, 3qsp:B |
3 | 5lzw:jj | 425 | 41 | 0.1772 | 0.0329 | 0.3415 | 1.5 | 5lzx:jj, 5lzy:jj, 5lzz:jj |
4 | 5lr8:A | 844 | 72 | 0.2658 | 0.0249 | 0.2917 | 2.3 | 5lr8:B, 5lra:A, 5lra:B, 5lrb:B, 5lrb:A |
5 | 3wbm:A | 86 | 37 | 0.1646 | 0.1512 | 0.3514 | 3.1 | 3wbm:B, 3wbm:C |
6 | 2bon:A | 287 | 27 | 0.1519 | 0.0418 | 0.4444 | 6.8 | |
7 | 6pnl:A | 336 | 49 | 0.1519 | 0.0357 | 0.2449 | 7.0 | 6pmh:A |
8 | 5na8:A | 651 | 35 | 0.1646 | 0.0200 | 0.3714 | 8.7 | 5na6:A, 5na7:A, 5na8:B |