ATDFVQWENSVRLIGVSLFPVNYDNIEFMGIRLELFDELSLKYDPPFYVILKPSVKRLGIWELFKHNLPKYINIHQHWQL
The query sequence (length=184) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
3zxu:A |
211 |
183 |
0.9946 |
0.8673 |
1.0000 |
1.71e-135 |
5mu3:A, 5mu3:D, 3zxu:C |
2 |
8cs9:g |
832 |
40 |
0.0761 |
0.0168 |
0.3500 |
1.0 |
8cs9:V, 8cs9:e, 8cs9:Y, 8cs9:f, 8cs9:Z, 8cte:P, 8cte:T, 7v0k:O, 7v0k:P |
3 |
7tvz:A |
850 |
40 |
0.0761 |
0.0165 |
0.3500 |
1.1 |
8crq:C, 8crq:E, 8crr:C, 8crr:E, 8crt:C, 8crt:E, 8ct3:C, 8ct3:E, 8t3r:B, 8t44:B, 8t47:B, 8t47:A, 8t6u:A, 8t6u:B, 8t6v:A, 8t6v:B, 7tvz:B, 7ty4:A, 7ty4:B, 7ty6:A, 7ty6:B, 7ty7:A, 7ty7:B, 7ty8:A, 7ty8:B, 7tya:A, 7tya:B, 7uz3:C, 7uz3:E, 7v07:C, 7v07:E, 7v19:C, 7v19:E |
4 |
3tqp:A |
418 |
118 |
0.1739 |
0.0766 |
0.2712 |
1.5 |
3tqp:B |
5 |
4yzf:A |
475 |
65 |
0.1033 |
0.0400 |
0.2923 |
4.4 |
4yzf:B, 4yzf:C, 4yzf:D |
6 |
8t45:A |
460 |
65 |
0.1033 |
0.0413 |
0.2923 |
4.4 |
8t3r:A, 8t3u:A, 8t3u:B, 8t44:A, 8t45:B |
7 |
7vlx:Z |
298 |
140 |
0.1576 |
0.0973 |
0.2071 |
6.6 |
7vlx:B, 7vlx:D, 7vly:Z, 7vly:D, 7vly:G |
8 |
7b6s:FFF |
271 |
90 |
0.1033 |
0.0701 |
0.2111 |
6.9 |
7b6s:AAA, 7b6s:BBB, 7b6s:CCC, 7b6s:DDD, 7b6s:EEE, 7b6s:GGG, 7b6s:HHH, 7b6s:III, 7b6s:JJJ, 7b6t:AAA, 7b6t:CCC, 7b6t:DDD, 7b6t:FFF, 7b6t:HHH, 7b6t:JJJ, 7b6t:GGG, 7b6t:III, 7b6u:AAA, 7b6u:BBB, 7b6u:CCC, 7b6u:DDD, 7b6u:EEE, 7b6u:FFF, 7b6u:GGG, 7b6u:HHH, 7b6u:III, 7b6u:JJJ, 7b6v:AAA, 7b6v:BBB, 7b6v:CCC, 7b6v:DDD, 7b6v:EEE, 7b6v:FFF, 7b6v:GGG, 7b6v:HHH, 7b6v:III, 7b6v:JJJ, 6y63:AAA, 6y63:BBB, 6y63:HHH, 6y63:III, 6y63:EEE, 6y63:DDD, 6y63:GGG, 6y64:D, 6y64:F, 6y64:G, 6y64:J, 6y64:B, 6y64:A, 6y64:C, 6y64:E, 6y64:H, 6y64:I |
9 |
2en8:A |
46 |
22 |
0.0489 |
0.1957 |
0.4091 |
8.9 |
|