ATDFNRGIMKFDGADSPAMIAISAVLILGFIAGLIWWALHTAYA
The query sequence (length=44) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6l7o:Q | 44 | 44 | 1.0000 | 1.0000 | 1.0000 | 3.98e-26 | 6l7p:Q |
2 | 8a6t:A | 571 | 30 | 0.2727 | 0.0210 | 0.4000 | 3.4 | 8a6t:D, 8bew:A, 8bew:D |
3 | 3suc:A | 767 | 33 | 0.2500 | 0.0143 | 0.3333 | 5.2 | 3gq7:A, 3gq8:A, 3gqa:A, 3gqk:A |
4 | 1q2l:A | 937 | 15 | 0.1818 | 0.0085 | 0.5333 | 6.1 | |
5 | 3p3i:A | 135 | 30 | 0.2500 | 0.0815 | 0.3667 | 6.7 | 3kuv:B, 3kuv:A, 3kuw:B, 3kuw:A, 3kv7:B, 3kv7:A, 3kv8:A, 3kv8:B, 3kvi:B, 3kvi:A, 3kvu:A, 3kvu:B, 3kvu:C, 3kvu:D, 3kvz:A, 3kvz:B, 3kvz:E, 3kvz:F, 3kw1:C, 3kw1:D, 3kw1:E, 3kw1:F, 3p2r:A, 3p2r:B, 3p3i:B, 3p3i:C, 3p3i:D |
6 | 8wew:A | 233 | 34 | 0.2955 | 0.0558 | 0.3824 | 9.4 | 8wew:B |