BioLiP

>protein
ASYSIGDLVFAKVKGYPPWPAKITKSNNKKYNVYFYGTGETANIKLEDLFPYASNKERFATEKIMKRAKFIEAIDQIESA
LRG

The query sequence (length=83) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6kcp:B	84	84	1.0000	0.9881	0.9881	2.79e-55	6kco:O, 6kco:F, 6kco:M, 6kco:E, 6kco:P, 6kco:B, 6kco:H, 6kco:D, 6kco:I, 6kco:N, 6kco:G, 6kco:J, 6kco:L, 6kco:A, 6kco:C, 6kco:K
2	5xsk:A	90	84	0.5060	0.4667	0.5000	7.32e-20
3	6iit:B	100	85	0.4699	0.3900	0.4588	9.19e-17	6iiq:A, 6iiq:B, 6iir:A, 6iir:B, 6iis:B, 6iis:A, 6iit:A
4	3qj6:A	90	83	0.4337	0.4000	0.4337	6.26e-16	3qby:B
5	8cbn:L	86	80	0.3976	0.3837	0.4125	7.51e-16	8cbn:K, 8cbq:K, 8pc5:K, 8pc6:L, 8pc6:K, 8peo:K, 8pep:L, 8pep:K, 6s01:K
6	9exw:A	148	49	0.2048	0.1149	0.3469	3.88e-05	9exw:B, 9exx:A, 9exx:B, 9exy:A, 7lmt:A, 7lmt:H, 7lmt:B, 7lmt:C, 7lmt:D, 7lmt:E, 7lmt:F, 7lmt:G, 7mdn:A, 7mdn:H, 7mdn:B, 7mdn:C, 7mdn:D, 7mdn:E, 7mdn:F, 7mdn:G, 6ue6:A, 6ue6:B, 6ue6:D, 6ue6:E, 6ue6:G, 6ue6:H, 5vc8:A, 7vln:B, 6xcg:A, 6xcg:B, 6xcg:C
7	9exy:B	135	96	0.3494	0.2148	0.3021	4.87e-05	6ue6:C, 6ue6:F
8	4n4g:A	209	77	0.2892	0.1148	0.3117	8.03e-05	4n4h:A, 4n4i:A, 4ns5:A
9	5b73:A	313	71	0.2410	0.0639	0.2817	3.61e-04	4cos:A, 7cwh:B, 5y1z:C, 5y1z:D
10	5ciu:B	121	65	0.2169	0.1488	0.2769	0.003
11	5nrr:B	137	65	0.2169	0.1314	0.2769	0.005	5ciu:A, 5nr3:A, 5nr3:B, 5nrr:A, 5nrs:A, 5nrs:B, 5nrv:D, 5nrv:A, 5nv0:A, 5nv0:B, 5nv2:A, 5nv2:B, 5nv7:A, 5nv7:B, 6r3e:A
12	6g2b:A	123	68	0.2289	0.1545	0.2794	0.013	6g24:A, 6g25:A, 6g27:A, 6g29:A, 6g2c:A, 6g2e:A, 6g2f:A, 6g2o:A
13	3mo8:A	127	32	0.1446	0.0945	0.3750	0.042	5c6s:A, 2x4w:A, 2x4x:A, 2x4x:C, 2x4x:E, 2x4x:G, 2x4y:A, 2x4y:C, 2x4y:E, 2x4y:G, 2x4y:I, 2x4y:K, 2x4y:M, 2x4y:O
14	1gq2:A	555	52	0.1928	0.0288	0.3077	0.54	1gq2:B, 1gq2:C, 1gq2:D, 1gq2:E, 1gq2:F, 1gq2:G, 1gq2:H, 1gq2:I, 1gq2:J, 1gq2:K, 1gq2:L, 1gq2:M, 1gq2:N, 1gq2:O, 1gq2:P
15	3hit:A	257	34	0.1325	0.0428	0.3235	2.3	3hit:B, 3hiv:A, 3hiv:B, 3hiw:A, 3hiw:B
16	7epk:A	426	87	0.2771	0.0540	0.2644	2.7
17	3p9t:A	213	30	0.1687	0.0657	0.4667	4.7
18	6mur:E	286	79	0.2410	0.0699	0.2532	5.3	6iqw:E, 6mus:E, 6mut:E, 6muu:E, 6o7e:E, 6o7h:E, 6o7i:E
19	8iuf:QD	241	32	0.1446	0.0498	0.3750	7.2	8iuf:Qd, 8iuj:QD, 8iuj:Qd
20	6fwf:A	712	19	0.1084	0.0126	0.4737	7.3

[Back]