ASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRAPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKD
HIGTRAIVLQLPQGTTLPKGFYA
The query sequence (length=103) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6wkp:A | 103 | 103 | 1.0000 | 1.0000 | 1.0000 | 1.37e-73 | |
2 | 7acs:A | 140 | 124 | 1.0000 | 0.7357 | 0.8306 | 3.00e-67 | 7act:A, 8iv3:D, 8j6x:A, 8j6x:D, 6vyo:A, 6vyo:B, 6vyo:C, 6vyo:D, 6wkp:B, 6wkp:C, 6wkp:D, 7xwz:A, 7xwz:B, 7xx1:A, 7xx1:B, 7xx1:C, 7xx1:D |
3 | 6lz8:D | 112 | 109 | 0.6214 | 0.5714 | 0.5872 | 1.13e-36 | 7dyd:D, 6kl5:C, 6kl6:D, 6lnn:D, 6lz6:D |
4 | 6lz8:B | 130 | 122 | 0.6214 | 0.4923 | 0.5246 | 1.52e-34 | 6kl5:A, 6kl6:B |
5 | 4kxj:A | 135 | 123 | 0.4854 | 0.3704 | 0.4065 | 1.08e-20 | 4li4:A, 4lm7:A, 4lm9:A, 4lmc:A, 4lmt:A |
6 | 8pme:C | 343 | 31 | 0.1262 | 0.0379 | 0.4194 | 0.51 | 8pme:B |
7 | 2owo:A | 586 | 24 | 0.1165 | 0.0205 | 0.5000 | 1.1 | 4glx:A, 5tt5:A |
8 | 6omp:A | 356 | 84 | 0.2330 | 0.0674 | 0.2857 | 1.2 | 6omp:B, 6omq:A, 6omq:B, 6omr:A, 6omr:B |
9 | 3crl:B | 383 | 53 | 0.1748 | 0.0470 | 0.3396 | 2.6 | 2bu2:A, 2bu5:A, 2bu6:A, 2bu7:A, 2bu8:A, 3crk:A, 3crk:B, 3crl:A, 7ea0:A, 7eas:A, 7ebh:A, 5j6a:A, 1jm6:A, 1jm6:B, 6lil:A, 6lil:B, 6lin:A, 6lin:B, 6lin:C, 6lin:D, 6lio:A, 6lio:B, 5m4k:A, 5m4m:A, 5m4n:A, 5m4p:A, 4mp2:A, 4mp7:A, 4mpc:A, 4mpe:A, 4mpn:A, 6tmp:AAA, 6tmq:AAA, 6tmz:AAA, 6tn0:AAA, 6tn2:AAA, 4v25:A, 4v26:A, 7vbu:A, 7vbv:A, 7vbv:B, 7vbx:A, 8zm1:A, 8zm2:A |
10 | 6u05:A | 413 | 14 | 0.0874 | 0.0218 | 0.6429 | 7.8 | 6tzm:A, 6tzo:A, 6tzx:A, 6u00:B, 6u03:A, 5u32:A |
11 | 6mf2:A | 1222 | 49 | 0.1456 | 0.0123 | 0.3061 | 8.9 | 4bdv:A, 4bdv:B, 3cdz:B, 3j2q:B, 5k8d:A, 5k8d:B, 2r7e:B |