BioLiP

>protein
ASTVYVPTETSDTSLTVKDGFQWRKYGQKVTRDNPSPRAYFRCSFAPSCPVKKKVQRSAEDPSLLVATYEGTHNHLGPNA

The query sequence (length=80) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7z0r:A	81	80	1.0000	0.9877	1.0000	7.98e-57	7z0r:B, 7z0u:A
2	2ayd:A	76	62	0.4500	0.4737	0.5806	8.21e-23
3	1wj2:A	71	69	0.4625	0.5211	0.5362	3.81e-22	2lex:A
4	8iex:A	88	73	0.4000	0.3636	0.4384	1.67e-20
5	8k31:B	79	73	0.4000	0.4051	0.4384	6.42e-20
6	6j4g:B	58	60	0.3750	0.5172	0.5000	6.12e-17
7	6j4f:B	63	62	0.3750	0.4762	0.4839	2.02e-16	6j4f:F
8	5w3x:D	73	62	0.3500	0.3836	0.4516	1.22e-12	7p8k:B, 5w3x:B
9	7d11:A	79	63	0.3250	0.3291	0.4127	1.58e-12	6j4e:B
10	6ir8:A	69	60	0.3125	0.3623	0.4167	3.61e-12
11	4rdv:B	451	30	0.1500	0.0266	0.4000	3.6	3mdu:A, 3mdw:A, 3mdw:B, 3mdw:C, 3mdw:D, 4rdv:A, 4rdv:C, 4rdv:D, 4rdw:A, 4rzb:A, 4rzb:B
12	2ysm:A	111	33	0.1500	0.1081	0.3636	5.2
13	8tqm:A	843	29	0.1375	0.0130	0.3793	7.7
14	5cxy:A	292	33	0.1500	0.0411	0.3636	7.7	5bo6:A, 5bo6:B, 5bo7:A, 5bo7:B, 5bo9:A, 5bo9:B, 5cxy:B
15	3o3u:N	580	28	0.1125	0.0155	0.3214	8.3	2l7u:A, 7lml:A, 7lml:B, 7lmw:A, 7lmw:B, 2mov:A, 4oi7:A, 4oi8:A, 4oi8:B, 6xq1:A, 6xq1:B, 6xq3:A, 6xq3:B, 6xq5:A, 6xq5:B, 6xq6:A, 6xq6:B, 6xq7:A, 6xq7:B, 6xq8:A, 6xq8:B, 6xq9:A, 6xq9:B
16	5w1j:A	584	32	0.1250	0.0171	0.3125	9.9	5w1j:B, 5w1l:A, 5w1l:B

[Back]