ASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKIPGFQCLAKNMPDPITARESIWLPFMETELHCDEKTIIIGHSSGAIAA
MRYAETHRVYAIVLVSAYTSDLGDENERASGYFTRPWQWEKIKANCPYIVQFGSTDDPFLPWKEQQEVADRLETKLHKFT
DCGHFQNTEFHELITVVKSLLKVPALEHHHHH
The query sequence (length=192) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7oex:A | 192 | 192 | 1.0000 | 1.0000 | 1.0000 | 2.84e-146 | 7oex:B |
2 | 1y7i:B | 262 | 96 | 0.1510 | 0.1107 | 0.3021 | 0.020 | 1xkl:A, 1xkl:B, 1xkl:C, 1xkl:D, 1y7i:A |
3 | 3bdv:A | 191 | 115 | 0.1354 | 0.1361 | 0.2261 | 1.3 | |
4 | 5ol2:A | 331 | 79 | 0.1042 | 0.0604 | 0.2532 | 2.8 | 5ol2:D |
5 | 3gzj:A | 254 | 134 | 0.1667 | 0.1260 | 0.2388 | 3.6 | 3gzj:B, 3gzj:C, 3gzj:D |
6 | 6qe2:A | 257 | 24 | 0.0573 | 0.0428 | 0.4583 | 4.0 | 6qe2:B |
7 | 3stu:B | 259 | 33 | 0.0677 | 0.0502 | 0.3939 | 4.9 | 3stv:A, 3stw:A, 3stw:B, 3stx:A, 3stx:B |
8 | 6jmg:A | 267 | 23 | 0.0573 | 0.0412 | 0.4783 | 5.5 | 6jmg:B |
9 | 8qd8:B | 413 | 100 | 0.1458 | 0.0678 | 0.2800 | 7.5 | 8qd8:A, 8qd9:A, 8qd9:B |
10 | 8yfq:R | 746 | 49 | 0.0625 | 0.0161 | 0.2449 | 7.6 | |
11 | 7zpq:CA | 1742 | 53 | 0.0781 | 0.0086 | 0.2830 | 7.7 | 7zrs:CA, 7zuw:CA |
12 | 7omd:B | 310 | 34 | 0.0781 | 0.0484 | 0.4412 | 8.1 | 7omd:A, 7omo:A, 7omr:A, 2psj:A, 2psj:B, 6yn2:A, 6yn2:B |
13 | 4g8b:A | 277 | 74 | 0.1094 | 0.0758 | 0.2838 | 9.1 | 4g8b:B, 4g8c:A, 4g8c:B, 4g9e:A, 4g9e:B |