ASNKSFPRDWVKTDPLVPVLGFAGWTIPANIGVSAFGGQSLFGLFTQSIGENLAHFPTGPALDDKFWLYLITYHLGLFLT
ITLGQIGVQGRKQ
The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7dz7:O | 97 | 93 | 1.0000 | 0.9588 | 1.0000 | 5.67e-64 | 7d0j:O, 7dz8:O |
2 | 6sl5:O | 86 | 83 | 0.5484 | 0.5930 | 0.6145 | 2.28e-36 | |
3 | 6zzx:O | 87 | 80 | 0.5376 | 0.5747 | 0.6250 | 9.29e-30 | |
4 | 8wgh:O | 89 | 88 | 0.5161 | 0.5393 | 0.5455 | 3.72e-27 | |
5 | 7yca:O | 96 | 89 | 0.4839 | 0.4688 | 0.5056 | 4.52e-27 | |
6 | 8htu:O | 90 | 88 | 0.5054 | 0.5222 | 0.5341 | 6.58e-26 | 7ksq:O, 7ku5:O, 7xqp:O |
7 | 8j6z:O | 86 | 86 | 0.4946 | 0.5349 | 0.5349 | 1.43e-25 | |
8 | 6fos:O | 98 | 84 | 0.4194 | 0.3980 | 0.4643 | 6.23e-17 | 7blz:O, 8wey:O, 5zgb:O, 5zgh:O |
9 | 5zji:O | 76 | 89 | 0.3763 | 0.4605 | 0.3933 | 5.14e-15 | |
10 | 8wm6:O | 104 | 78 | 0.3656 | 0.3269 | 0.4359 | 1.54e-14 | 8wmv:O, 8wmw:O |
11 | 7y5e:ON | 92 | 83 | 0.3333 | 0.3370 | 0.3735 | 3.44e-14 | 7y5e:O2, 7y7a:O7, 7y7a:Oo |
12 | 7y7b:O | 99 | 79 | 0.3226 | 0.3030 | 0.3797 | 4.98e-12 | 7y8a:O |
13 | 2c8s:A | 149 | 54 | 0.2258 | 0.1409 | 0.3889 | 0.004 | |
14 | 1n7d:A | 639 | 49 | 0.1828 | 0.0266 | 0.3469 | 0.67 | 1ajj:A, 3bps:E, 1d2j:A, 1f8z:A, 2fcw:B, 3gcw:E, 3gcx:E, 1hj7:A, 1hz8:A, 1i0u:A, 2kri:B, 2lgp:A, 3m0c:C, 3p5b:L, 3p5c:L, 1xfe:A |
15 | 7dsk:B | 464 | 43 | 0.1720 | 0.0345 | 0.3721 | 2.4 | 7dsl:B, 7dsn:B, 7dsq:B, 8ida:B, 6irt:B, 8j8l:B, 8j8m:B, 8xpu:B |
16 | 8t5c:I | 109 | 42 | 0.1505 | 0.1284 | 0.3333 | 2.9 | 8t5c:L |
17 | 2d0w:A | 168 | 33 | 0.1613 | 0.0893 | 0.4545 | 3.0 | 2d0w:B |
18 | 8i01:A | 594 | 28 | 0.1290 | 0.0202 | 0.4286 | 3.1 | 8beo:A, 8beo:B, 8beo:C, 8beo:E, 8beo:D, 8beo:F, 8i01:B, 8i01:C, 8i01:E, 8i01:D, 8i01:F, 8i05:A, 8i05:B, 8i05:C, 8i05:E, 8i05:D, 8i05:F, 8i07:A, 8i07:B, 8i07:C, 8i07:E, 8i07:D, 8i07:F, 8i08:A, 8i08:B, 8i08:C, 8i08:E, 8i08:D, 8i08:F, 2pan:A, 2pan:B, 2pan:C, 2pan:D, 2pan:E, 2pan:F |
19 | 8wnt:B | 463 | 48 | 0.1720 | 0.0346 | 0.3333 | 6.3 | 8qey:A, 8wny:B |
20 | 7fgp:A | 379 | 19 | 0.0968 | 0.0237 | 0.4737 | 7.9 | 7fgp:B |
21 | 2zyj:A | 397 | 23 | 0.1183 | 0.0277 | 0.4783 | 9.8 | 3cbf:A, 3cbf:B, 2egy:A, 2egy:B, 2egy:C, 2egy:D, 2z1y:A, 2z1y:B, 2zp7:A, 2zp7:C, 2zp7:B, 2zp7:D, 2zp7:E, 2zp7:F, 2zyj:B |