ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVA
The query sequence (length=129) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
1aq3:A |
129 |
129 |
0.9845 |
0.9845 |
0.9845 |
4.62e-92 |
1aq3:C, 1aq4:A, 1aq4:C, 2b2d:A, 2b2d:B, 2b2d:C, 2b2e:A, 2b2e:B, 2b2e:C, 2b2g:A, 2b2g:B, 2b2g:C, 2bny:A, 2bny:B, 2bny:C, 2bq5:A, 2bq5:B, 2bq5:C, 2bs0:A, 2bs0:B, 2bs0:C, 2bs1:A, 2bs1:B, 2bs1:C, 2bu1:A, 2bu1:B, 2bu1:C, 2c4q:A, 2c4q:B, 2c4q:C, 2c4y:A, 2c4y:B, 2c4y:C, 2c4z:A, 2c4z:B, 2c4z:C, 2c50:A, 2c50:B, 2c50:C, 2c51:A, 2c51:B, 2c51:C, 2iz8:A, 2iz8:B, 2iz8:C, 2iz9:A, 2iz9:C, 2izm:A, 2izm:B, 2izm:C, 2izn:A, 2izn:B, 2izn:C, 5msf:A, 5msf:C, 6msf:A, 6msf:C, 7msf:A, 7msf:C, 5tc1:D, 5tc1:E, 5tc1:G, 5tc1:H, 1u1y:A, 1u1y:C, 1zdh:A, 1zdh:C, 1zdi:A, 1zdi:C, 1zdj:A, 1zdj:C, 1zdk:A, 1zdk:C, 1zse:A, 1zse:B |
2 |
4ang:A |
131 |
126 |
0.2791 |
0.2748 |
0.2857 |
6.60e-06 |
4ang:B, 4ang:C |
3 |
8jze:f |
184 |
65 |
0.1318 |
0.0924 |
0.2615 |
0.14 |
8jzf:f |
4 |
8jjr:f |
169 |
34 |
0.0853 |
0.0651 |
0.3235 |
1.2 |
|
5 |
4fe1:F |
141 |
76 |
0.2016 |
0.1844 |
0.3421 |
1.4 |
7fix:F1, 7fix:F2, 7fix:F3, 1jb0:F, 6k33:bF, 6k33:aF, 6k33:cF, 7m75:F, 7m76:F, 7m78:F, 3pcq:F, 6pfy:Q, 6pfy:F, 6pfy:d, 6pgk:Q, 6pgk:F, 6pgk:d, 6tra:F, 6trc:F, 6trc:f, 6trc:6, 6trd:F, 6trd:f, 6trd:6, 5zf0:F1, 5zf0:F2, 5zf0:F3, 5zf0:F4, 5zf0:F6, 5zf0:F5 |
6 |
3rss:A |
494 |
66 |
0.1395 |
0.0364 |
0.2727 |
2.4 |
2ax3:A, 3rrb:A, 3rre:A, 3rrf:A, 3rrj:A, 3rs8:A, 3rs9:A, 3rsf:A, 3rsg:A, 3rsq:A, 3rt7:A, 3rt9:A, 3rta:A, 3rtb:A, 3rtc:A, 3rtd:A, 3rte:A, 3rtg:A, 3ru2:A, 3ru3:A |
7 |
6ly5:f |
162 |
71 |
0.1550 |
0.1235 |
0.2817 |
2.8 |
3lw5:F, 2o01:F, 2wsc:F, 2wse:F, 2wsf:F, 4xk8:F, 4xk8:f |
8 |
5l8r:F |
154 |
62 |
0.1395 |
0.1169 |
0.2903 |
3.9 |
7dkz:F, 4rku:F, 4y28:F, 6yac:F, 6yez:F, 6zoo:F, 6zxs:F |
9 |
4cvq:A |
404 |
44 |
0.1318 |
0.0421 |
0.3864 |
3.9 |
4cvq:B |
10 |
7wfe:BF |
154 |
62 |
0.1473 |
0.1234 |
0.3065 |
5.1 |
8j6z:F, 8j7a:F, 8j7b:F, 7wfd:AF, 7wg5:AF, 7wg5:BF, 8wgh:F |
11 |
6joo:A |
834 |
60 |
0.1473 |
0.0228 |
0.3167 |
5.5 |
|
12 |
2h0k:A |
318 |
32 |
0.0930 |
0.0377 |
0.3750 |
5.9 |
2h0k:B, 2h0l:A, 2ie6:A, 2ie7:A, 1n41:A, 1n42:A, 1n44:A, 2ran:A |
13 |
8i6y:A |
844 |
29 |
0.0775 |
0.0118 |
0.3448 |
8.4 |
8i6y:B |