ASLRYRRPYWMMFLKGVDNWKIYTVIQQPDHQRTEMLYQAWLGGLDRPYTRPKCMANQPLWLSKKRHMLRKERLDGPETP
LEKYVLEWHKKFHSFQGTERPTPDDLHTALDLVERPLDLSYALQLLGQCRNLNNIRFAKETFLVFLEACLRVGRRDCAEY
ALEHAEPLGFWFIDEDHRRYLQGEQTWYKLSPLDNLYYPVEENAKLN
The query sequence (length=207) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6sga:DP | 212 | 207 | 1.0000 | 0.9764 | 1.0000 | 1.93e-156 | 6hiv:DP, 6hiw:DP, 6hiy:DP, 7pua:DP, 7pub:DP, 6sgb:DP |
2 | 7aor:aq | 198 | 198 | 0.8454 | 0.8838 | 0.8838 | 1.32e-133 | |
3 | 7ane:aq | 212 | 207 | 0.7874 | 0.7689 | 0.7874 | 1.78e-123 | |
4 | 7z8f:e | 4579 | 97 | 0.1353 | 0.0061 | 0.2887 | 2.7 | 5owo:A, 8pr2:f, 8ptk:m, 8ptk:n, 7z8f:f, 7z8f:m, 7z8f:n, 7z8h:A |
5 | 8ptk:f | 4502 | 97 | 0.1353 | 0.0062 | 0.2887 | 2.8 | 8ptk:e |
6 | 8dy7:H | 85 | 30 | 0.0628 | 0.1529 | 0.4333 | 8.5 | 8dy9:H |
7 | 8b1t:B | 1141 | 101 | 0.1353 | 0.0245 | 0.2772 | 9.8 | 8b1u:B, 7mr3:B, 6sjb:B, 6sje:B, 6sjf:B, 6sjg:B, 6t2u:B, 6t2v:B |