BioLiP

>protein
ASLISNTVKTFGLTDIIKHKKIPYKNIYELASQYPGTGIGFKFWRKTWPSNSFYVLQDIDLKGTRHGNAYGILYWKGIQQ
SNTPVRIRNGNKRGVWRYDINNTSVVLDNGLTYNASDLSAYKK

The query sequence (length=123) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6z1p:Bz	123	123	1.0000	1.0000	1.0000	4.94e-88
2	6xyw:By	76	74	0.1951	0.3158	0.3243	6.83e-07
3	7ane:t	226	86	0.2276	0.1239	0.3256	4.94e-04
4	7aor:t	226	67	0.2114	0.1150	0.3881	0.001
5	7pub:Cj	227	92	0.2439	0.1322	0.3261	0.002	6hiv:Cj, 6hiw:Cj, 6hiy:Cj, 7pua:Cj, 6sga:Cj, 6sgb:Cj
6	8a22:Bz	119	68	0.1951	0.2017	0.3529	0.075	8apn:Bz, 8apo:Bz
7	2rhp:A	622	80	0.1626	0.0322	0.2500	1.1	1yo8:A
8	8glw:A	483	24	0.0732	0.0186	0.3750	1.4	8glu:G, 8glu:F, 8glu:E, 8glw:E, 8glw:F, 8glw:B, 8glw:C, 8glw:D, 8glw:G, 8glx:F, 8glx:B, 8glx:G, 8glx:E, 8glx:C, 8glx:A, 7mbw:A, 7mbw:B, 7mbw:C, 7mbw:D, 7mcs:A, 7mcs:D, 7mcs:B, 7mcs:C, 7mcs:E, 7mcs:F, 8vcj:B, 8vcj:F, 8vcj:C, 8vcj:A, 8vcj:D, 8vcj:E, 8vcj:G, 8vct:C, 8vct:B, 8vct:G, 8vct:E, 8vct:F, 8vct:A
9	1n7d:A	639	45	0.1057	0.0203	0.2889	4.5	1ajj:A, 3bps:E, 1d2j:A, 1f8z:A, 2fcw:B, 3gcw:E, 3gcx:E, 1hj7:A, 1hz8:A, 1i0u:A, 2kri:B, 2lgp:A, 3m0c:C, 3p5b:L, 3p5c:L, 1xfe:A
10	3jd5:j	213	71	0.1626	0.0939	0.2817	7.8	6neq:j, 6nf8:j
11	7cyi:D	378	25	0.0894	0.0291	0.4400	7.8	7cyi:A, 7cyi:B, 7cyi:C, 6ljh:A
12	7lo1:A	422	25	0.0894	0.0261	0.4400	8.3	7lo1:B

[Back]