ASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHENVKYLPGHKLPPNVVAVPDVVQ
AAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLKLISEVIGERLGIPMSVLMGANIASEVADEKF
CETTIGCKDPAQGQLLKELMQTPNFRITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKL
FCSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGPETARELYSILQHKGLVDKFPL
FMAVYKVCYEGQPVGEFIHCLQNHPEHM
The query sequence (length=348) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1x0x:A | 350 | 348 | 1.0000 | 0.9943 | 1.0000 | 0.0 | 6e8y:A, 6e8z:A, 6e8z:B, 6e90:A, 6e90:B, 6e90:C, 6e90:D, 6pyp:A, 6pyp:B, 1wpq:A, 1wpq:B, 1x0v:A, 1x0v:B |
2 | 2pla:A | 343 | 343 | 0.7040 | 0.7143 | 0.7143 | 0.0 | 2pla:B |
3 | 6iuy:A | 585 | 339 | 0.4511 | 0.2684 | 0.4631 | 9.36e-90 | 6iuy:B |
4 | 1z82:A | 312 | 332 | 0.2902 | 0.3237 | 0.3042 | 9.12e-34 | 1z82:B |
5 | 1n1e:A | 349 | 337 | 0.2989 | 0.2980 | 0.3086 | 1.97e-30 | 1evz:A, 1jdj:A, 1m66:A, 1m67:A, 1n1e:B, 1n1g:A |
6 | 1txg:A | 335 | 356 | 0.2644 | 0.2746 | 0.2584 | 6.61e-09 | 1txg:B |
7 | 3zk4:B | 571 | 52 | 0.0603 | 0.0368 | 0.4038 | 1.9 | 3zk4:A, 3zk4:C |
8 | 1zuw:C | 262 | 23 | 0.0345 | 0.0458 | 0.5217 | 2.3 | 1zuw:A, 1zuw:B |
9 | 5z20:F | 336 | 47 | 0.0402 | 0.0417 | 0.2979 | 2.3 | 5z20:A, 5z20:B, 5z20:C, 5z20:D, 5z20:E |
10 | 7yni:A | 566 | 85 | 0.0805 | 0.0495 | 0.3294 | 2.6 | |
11 | 7wmv:A | 602 | 59 | 0.0632 | 0.0365 | 0.3729 | 3.1 | |
12 | 7sla:A | 585 | 59 | 0.0603 | 0.0359 | 0.3559 | 4.7 | 7sl8:A |
13 | 4kqx:B | 335 | 40 | 0.0431 | 0.0448 | 0.3750 | 4.8 | 4kqw:A, 4kqw:B, 4kqx:A |
14 | 4wj3:M | 589 | 75 | 0.0718 | 0.0424 | 0.3333 | 5.8 | 4wj3:N, 4wj3:O, 4wj3:P, 4wj4:A |
15 | 3pyz:A | 410 | 115 | 0.0833 | 0.0707 | 0.2522 | 7.4 | 3n2a:A, 3qcz:A |
16 | 3dgb:A | 371 | 80 | 0.0603 | 0.0566 | 0.2625 | 9.7 | 3ct2:A, 3ct2:B, 3fj4:A, 3fj4:B |