ASGLTIYFKKPDSWGTPHLYYYDTNPKVDEPTWSEAPEMEHYEGDWYTHTIEGVESVRLLFKDRGTNQWPGPGEPGFFRD
QDGWFDGEWHVDRP
The query sequence (length=94) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2c3h:B | 94 | 94 | 1.0000 | 1.0000 | 1.0000 | 1.23e-66 | 2c3h:A, 2c3h:H, 2c3h:C, 2c3h:D, 2c3h:E, 2c3h:F, 2c3h:G |
2 | 1xdq:C | 264 | 31 | 0.1383 | 0.0492 | 0.4194 | 1.0 | 1xdq:A, 1xdq:B, 1xdq:D, 1xdq:E |
3 | 3rsc:A | 397 | 18 | 0.1277 | 0.0302 | 0.6667 | 1.5 | 3iaa:A, 3iaa:B, 3rsc:B |
4 | 7os0:A | 1130 | 37 | 0.1277 | 0.0106 | 0.3243 | 4.6 | 7os0:C |