ASATRVIQLLRNWASGRDLQAKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGRREAMPPSIVMSSQKTEKKAVT
PAPPIKRWELSKDQPYL
The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7vb7:I | 97 | 97 | 1.0000 | 1.0000 | 1.0000 | 3.86e-68 | 5lnk:h, 6q9d:A7, 7vbn:I, 7vbz:I, 7vwj:I, 7vxp:I, 7vxu:I, 7vy8:I, 7vya:I, 7vyf:I, 7vyh:I, 7vyn:I, 7vz1:I, 5xtb:I |
2 | 3qg6:B | 209 | 37 | 0.1237 | 0.0574 | 0.3243 | 0.11 | 3qg6:H |
3 | 5eoc:J | 214 | 47 | 0.1753 | 0.0794 | 0.3617 | 1.8 | 5eoc:H |
4 | 5fzo:A | 339 | 32 | 0.1031 | 0.0295 | 0.3125 | 3.5 | 5fzo:B, 2ypd:A, 2ypd:B |
5 | 1pp9:O | 424 | 19 | 0.1031 | 0.0236 | 0.5263 | 3.9 | 2a06:B, 4d6t:B, 4d6t:O, 4d6u:B, 4d6u:O, 7dgq:l, 7dgq:x, 7dgr:l, 7dgr:x, 7dgs:l, 7dgs:x, 6fo0:O, 6fo0:B, 6fo2:O, 6fo2:B, 1pp9:B, 1ppj:O, 1ppj:B, 6qbx:a2, 6qbx:a4, 6qc3:a2, 6qc3:a4, 7tz6:B, 7tz6:O |
6 | 5tkk:H | 213 | 37 | 0.1340 | 0.0610 | 0.3514 | 4.4 | |
7 | 1fl6:H | 219 | 40 | 0.1443 | 0.0639 | 0.3500 | 4.6 | 1fl6:B |
8 | 8szq:A | 861 | 73 | 0.1856 | 0.0209 | 0.2466 | 5.4 | 3llm:A, 3llm:B, 8szp:A, 8szp:B, 8szr:A, 8szs:A |
9 | 6zxd:k | 430 | 76 | 0.2165 | 0.0488 | 0.2763 | 5.5 | 6zxe:k, 6zxf:k, 6zxg:k |
10 | 2e18:A | 256 | 33 | 0.1237 | 0.0469 | 0.3636 | 8.7 | 2e18:B |