ASATEMIGYAWAMVVVIVGATIGIKLFKKFTSKAS
The query sequence (length=35) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8b3p:LLL | 46 | 35 | 1.0000 | 0.7609 | 1.0000 | 2.00e-18 | 8b3o:KKK, 8b3o:LLL, 8b3o:MMM, 8b3o:NNN, 8b3o:OOO, 8b3p:NNN, 8b3p:OOO, 8ixl:A, 8ixl:N, 8ixl:V, 8ixl:DA, 8ixl:Z, 8jww:A, 8jww:N, 8jww:V, 8jww:DA, 8jww:Z |
2 | 7e9y:A | 563 | 25 | 0.2571 | 0.0160 | 0.3600 | 1.9 | |
3 | 2zzv:A | 330 | 25 | 0.2571 | 0.0273 | 0.3600 | 3.7 | 2zzv:B, 2zzw:A, 2zzw:B, 2zzx:C |