BioLiP

>protein
ARPAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSGNNDSRW
EFENERHA

The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1fyk:A	88	88	1.0000	1.0000	1.0000	5.21e-62	3hts:B
2	5d8k:B	106	72	0.4545	0.3774	0.5556	4.15e-26	5d8l:B, 5d8l:D, 5d8l:F, 5d8l:H, 7dcu:B
3	7dcu:A	101	68	0.4432	0.3861	0.5735	2.50e-25	7dci:A, 7dcu:C
4	7dcj:B	110	73	0.4545	0.3636	0.5479	1.78e-24	5d5u:B, 5d5v:B, 5d5v:D, 7dcj:A, 7dcs:A, 7dcs:B, 7dcs:C, 7dcs:D, 7dcs:E, 7dcs:F, 7dct:A, 7dct:B, 7dct:C, 7dct:D, 7dct:E, 7dct:F, 5hdn:A, 5hdn:C
5	5d5x:B	99	80	0.4432	0.3939	0.4875	1.98e-21	5d5w:B, 5d5x:E
6	6ph4:B	460	41	0.1591	0.0304	0.3415	0.58	5epv:A, 5epv:B, 5epv:C, 5epv:D, 6ph2:A, 6ph2:B, 6ph2:C, 6ph2:D, 6ph3:A, 6ph3:B, 6ph3:C, 6ph3:D, 6ph4:A, 6pps:A, 6pps:B, 6pps:C, 6pps:D, 3t50:A, 3t50:B
7	7eld:A	1137	38	0.1818	0.0141	0.4211	2.7	7ele:A
8	3og2:A	986	33	0.1364	0.0122	0.3636	5.2	3ogr:A, 3ogs:A, 3ogv:A
9	7qxa:A	954	29	0.1477	0.0136	0.4483	9.2	7bg9:A, 7qxb:A, 7qxs:A, 7trd:A, 7tre:A, 7trf:A
10	7v99:A	991	29	0.1477	0.0131	0.4483	9.2	5ugw:A
11	4q51:A	264	64	0.1591	0.0530	0.2188	9.7
12	4v8p:BK	148	16	0.0795	0.0473	0.4375	10.0	4v8p:CK, 4v8p:EK, 4v8p:GK

[Back]