BioLiP

>protein
ARMLAERQAKVRALVEAAHGLVEHQGARAARGEISADEARRAALEALRALRYDGSEYFWVNDLEPRMVMHPTNPQLDGQD
LSGYRDPNGKLLFQEFVRTVRARGSGFVDYLWPKPGSTVPVPKISFVTQYQPWGWVVGSGLYVD

The query sequence (length=144) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4k08:A	144	144	1.0000	1.0000	1.0000	8.06e-105
2	4exo:A	146	105	0.2292	0.2260	0.3143	2.01e-18
3	3ub9:B	165	124	0.2153	0.1879	0.2500	0.004	3ub6:A, 3ub6:B, 3ub8:B, 3ub8:A, 3ub9:A
4	2pzi:A	654	61	0.1458	0.0321	0.3443	1.8	2pzi:B, 7q52:AAA, 4y0x:A, 4y12:A
5	8dqo:B	437	39	0.1042	0.0343	0.3846	4.0	8dqo:A, 8dqp:A, 8dqp:B, 8dqq:A, 8dqq:B, 8dqr:A
6	8r2j:B	275	49	0.1250	0.0655	0.3673	4.2	8r2j:A
7	7mex:A	1737	36	0.0764	0.0063	0.3056	8.0	6kgi:B, 7mey:A, 3nih:A, 3nii:A, 3nij:A, 3nik:B, 3nik:D, 3nik:A, 3nik:F, 3nil:D, 3nil:A, 3nil:B, 3nil:F, 3nim:B, 3nim:F, 3nim:A, 3nim:D, 3nin:A, 3nin:B, 3nis:A, 3nis:B, 3nis:D, 3nis:F, 3nit:A
8	2bhp:A	516	49	0.1042	0.0291	0.3061	9.2	2bhp:B, 2bhq:A, 2bhq:B, 2bja:A, 2bja:B, 2bjk:A, 2bjk:B, 2ehq:A, 2ehq:B, 2ehu:A, 2ehu:B, 2eii:A, 2eii:B, 2eit:A, 2eit:B, 2eiw:A, 2eiw:B, 2ej6:A, 2ej6:B, 2ejd:A, 2ejd:B, 2ejl:A, 2ejl:B, 2j40:A, 2j40:B, 2j5n:A, 2j5n:B

[Back]