ARKVKQYKNPHTGEVIETKGGNHKTLKEWKAKWGPEAVESWATLLGH
The query sequence (length=47) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2mxf:A | 47 | 47 | 1.0000 | 1.0000 | 1.0000 | 7.15e-29 | |
2 | 1t0s:B | 323 | 30 | 0.2553 | 0.0372 | 0.4000 | 1.3 | |
3 | 7nac:p | 337 | 52 | 0.3830 | 0.0534 | 0.3462 | 1.9 | 7nad:p, 7r72:p, 7r7a:p |
4 | 5afe:A | 124 | 27 | 0.2340 | 0.0887 | 0.4074 | 3.0 | 2ypj:A |
5 | 1tah:B | 318 | 36 | 0.2766 | 0.0409 | 0.3611 | 3.2 | 1cvl:A, 2es4:A, 2es4:B, 1qge:E, 1tah:A, 1tah:C, 1tah:D |
6 | 5ze8:A | 385 | 44 | 0.2553 | 0.0312 | 0.2727 | 4.0 | |
7 | 7olc:SI | 201 | 41 | 0.2553 | 0.0597 | 0.2927 | 4.5 | 7old:SI, 8oo0:SI, 5oql:q, 7r81:J2, 7z3n:SI, 7z3o:SI |
8 | 7va2:A | 180 | 17 | 0.1915 | 0.0500 | 0.5294 | 4.8 | 7va3:A, 7va3:B, 7va6:A, 7va6:B |
9 | 6rxu:Cf | 174 | 41 | 0.2553 | 0.0690 | 0.2927 | 5.0 | 6rxv:Cf, 6rxx:Cf, 6rxz:Cf |
10 | 1pj6:A | 828 | 25 | 0.1915 | 0.0109 | 0.3600 | 7.5 | 3gsi:A, 1pj5:A, 1pj7:A |