AREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHM
The query sequence (length=50) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8osl:N | 290 | 50 | 1.0000 | 0.1724 | 1.0000 | 1.51e-29 | 4h10:A, 8osk:N, 8osl:P |
2 | 5nj8:D | 134 | 50 | 0.6600 | 0.2463 | 0.6600 | 5.02e-20 | |
3 | 7xi4:A | 283 | 50 | 0.6600 | 0.1166 | 0.6600 | 6.87e-19 | 8g4a:A, 8g4a:B, 5nj8:B, 5sy7:A, 5v0l:A, 7xhv:A, 4zph:A, 4zpk:A |
4 | 7xi3:A | 287 | 50 | 0.6400 | 0.1115 | 0.6400 | 2.67e-18 | |
5 | 4zpr:A | 235 | 50 | 0.6400 | 0.1362 | 0.6400 | 1.15e-15 | |
6 | 8ia3:E | 111 | 61 | 0.4200 | 0.1892 | 0.3443 | 2.64e-07 | 8ia3:A, 8ia3:B, 8ia3:F |
7 | 5nj8:A | 176 | 41 | 0.4000 | 0.1136 | 0.4878 | 3.29e-07 | 5nj8:C, 5v0l:B |
8 | 8osk:M | 316 | 49 | 0.3800 | 0.0601 | 0.3878 | 1.93e-05 | 4h10:B, 8osl:M, 8osl:O |
9 | 7d8t:A | 199 | 49 | 0.3400 | 0.0854 | 0.3469 | 3.00e-05 | 4ati:A, 4ati:B, 4atk:A, 4atk:B, 7d8t:B, 6g1l:A, 8vu0:A, 8vu0:B |
10 | 1an4:A | 65 | 35 | 0.2800 | 0.2154 | 0.4000 | 6.98e-05 | 1an4:B |
11 | 1am9:C | 82 | 49 | 0.4400 | 0.2683 | 0.4490 | 1.90e-04 | 1am9:D, 1am9:A, 1am9:B |
12 | 5sy7:B | 276 | 49 | 0.3000 | 0.0543 | 0.3061 | 0.003 | |
13 | 7f2f:B | 94 | 56 | 0.3600 | 0.1915 | 0.3214 | 0.011 | 7f2f:A |
14 | 8ow1:B | 116 | 49 | 0.2800 | 0.1207 | 0.2857 | 0.014 | 8ovw:A, 8ovw:B, 8ow0:A, 8ow0:B, 8ow1:A, 7ssa:L, 7ssa:K |
15 | 1a0a:A | 63 | 27 | 0.2400 | 0.1905 | 0.4444 | 0.016 | 1a0a:B |
16 | 8gs1:B | 332 | 33 | 0.2400 | 0.0361 | 0.3636 | 0.13 | 7wux:C, 7wux:D |
17 | 4zpk:B | 321 | 39 | 0.2600 | 0.0405 | 0.3333 | 0.18 | 8ck3:A, 8ck4:A, 8ck8:A, 6czw:A, 6d09:A, 6d0b:A, 6e3s:B, 6e3t:B, 6e3u:B, 3f1o:A, 4ghi:A, 4gs9:A, 3h7w:A, 3h82:A, 5tbm:A, 5ufp:A, 7w80:B, 6x21:A, 6x28:A, 6x2h:A, 6x37:A, 6x3d:A, 4xt2:C, 4zqd:B |
18 | 5gnj:B | 77 | 46 | 0.2800 | 0.1818 | 0.3043 | 0.19 | 5gnj:G, 5gnj:I, 5gnj:A, 5gnj:E, 5gnj:F, 5gnj:M, 5gnj:N |
19 | 4zpr:B | 279 | 41 | 0.2600 | 0.0466 | 0.3171 | 0.20 | |
20 | 8hov:A | 87 | 39 | 0.2600 | 0.1494 | 0.3333 | 0.24 | 8hov:C, 8hov:B, 8hov:D, 8hov:E, 8hov:F |
21 | 7xi3:B | 314 | 37 | 0.2600 | 0.0414 | 0.3514 | 0.38 | 7xhv:B, 7xi4:B |
22 | 1nlw:A | 79 | 35 | 0.2400 | 0.1519 | 0.3429 | 1.3 | 1nlw:D |
23 | 7xq5:A | 75 | 24 | 0.2000 | 0.1333 | 0.4167 | 4.1 | |
24 | 2wef:A | 303 | 36 | 0.2200 | 0.0363 | 0.3056 | 6.5 | 1jp4:A |
25 | 7msk:A | 421 | 23 | 0.1800 | 0.0214 | 0.3913 | 6.8 | 7msk:B |
26 | 8c7s:A | 256 | 14 | 0.1800 | 0.0352 | 0.6429 | 9.6 | 8c7s:B, 5ey0:B, 5ey0:A, 5ey1:A, 5ey1:B |