BioLiP

>protein
ARDLTAFQKNILTVLGEEARYGLAIKRELEEYYGEEVNHGRLYPNLDDLVNKGLVEKSELDKRTNEYALTNEGFDAVVDD
LEWTLSKFVADADRRERVETIVADDAAALE

The query sequence (length=110) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6qfd:B	116	110	1.0000	0.9483	1.0000	2.86e-75	6qfd:A, 6qfd:C, 6qfd:D, 6qh0:C, 6qh0:D, 6qh0:A, 6qh0:B, 6qil:A, 6qil:B, 6qil:C, 6qil:D, 6qua:A, 6qua:B, 6qua:C, 6qua:D
2	4v3p:SC	195	100	0.2727	0.1538	0.3000	0.39	8ip8:eb, 8ip9:eb, 8ipa:eb, 8ipb:eb, 8jiw:BJ, 8r6f:J, 4v7e:BJ
3	7jps:B	199	74	0.2000	0.1106	0.2973	0.47
4	8baq:A	208	28	0.1091	0.0577	0.4286	0.68	8bar:A, 8bas:A
5	2w41:B	507	69	0.1727	0.0375	0.2754	0.88	2w40:A, 2w40:B, 2w40:C, 2w40:D, 2w41:A
6	7qix:Q	184	100	0.2636	0.1576	0.2900	1.1	8auv:b, 8b2l:b1, 7qiz:GA
7	7suk:LP	359	35	0.1455	0.0446	0.4571	1.7	5wlc:LP
8	5zi8:A	104	78	0.2182	0.2308	0.3077	1.8	7wh4:A, 7wh4:B, 5zhv:A, 5zhv:B, 5zi8:B
9	6tcv:B	397	116	0.2818	0.0781	0.2672	1.9
10	7d4i:B6	377	35	0.1455	0.0424	0.4571	3.2	7ajt:UF, 7d5s:B6, 7d5t:B6, 7d63:B6, 6ke6:B6, 6lqp:B6, 6lqq:B6, 6lqr:B6, 6lqs:B6, 6lqt:B6, 6lqu:B6, 6lqv:B6, 6zqa:UF, 6zqb:UF, 6zqc:UF
11	2qgy:A	376	32	0.1091	0.0319	0.3750	3.9	2qgy:B
12	6ya7:A	350	44	0.1182	0.0371	0.2955	6.7	6ya6:A, 6ya8:A
13	6git:A	507	30	0.1000	0.0217	0.3667	9.0	6giz:A, 6gj2:A, 6gj9:A, 6gja:A

[Back]