BioLiP

>protein
ARCNYKIQLDSNKIVDTVDIEDIGEKKAFCRCWKSEKWPYCDGSHGKHNKETGDNVGPLIVKS

The query sequence (length=63) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7yvz:A	63	63	1.0000	1.0000	1.0000	8.65e-43
2	3ew0:A	77	62	0.6032	0.4935	0.6129	8.01e-26	6de9:A, 3ew0:B, 4ezf:A, 4ezf:B, 4f1e:A, 4f1e:B, 4f1e:C, 4f1e:D, 4f1e:E, 4f1e:F, 4f1e:G, 4f1e:H, 4f1e:I, 4f1e:J, 4f1e:K, 4f1e:L, 4f1e:M, 4f1e:N, 4f1e:O, 4f1e:P, 4f1e:Q, 4f1e:R, 4f28:A, 4f28:B, 4f2c:A, 4f2c:B, 3lpq:A, 3lpq:B, 7p0o:A, 7p0o:B, 2qd0:A, 2qd0:B, 2qh7:A, 2qh7:B, 2r13:A, 3ree:A
3	3fnv:B	68	60	0.5556	0.5147	0.5833	1.74e-21	3fnv:A, 4oo7:A, 4oo7:B, 4ooa:A, 4ooa:B, 4ooa:C, 4ooa:D, 4ooa:E, 4ooa:F, 7p0p:A, 7p0p:B, 7p0p:C, 7p0p:D
4	3s2r:B	78	60	0.4444	0.3590	0.4667	4.46e-15	3s2q:A, 3s2q:B, 3s2r:A
5	3tbo:A	54	19	0.1587	0.1852	0.5263	0.091
6	3tbm:A	61	17	0.1587	0.1639	0.5882	0.21	3tbm:B
7	3tbn:A	87	35	0.2063	0.1494	0.3714	0.25
8	3tbn:A	87	17	0.1429	0.1034	0.5294	3.6
9	6avj:A	92	32	0.1587	0.1087	0.3125	0.80	6avj:B, 6avj:C
10	6avj:A	92	28	0.1746	0.1196	0.3929	2.2	6avj:B, 6avj:C
11	6z1p:AV	129	29	0.2063	0.1008	0.4483	1.1
12	6deb:B	284	22	0.1429	0.0317	0.4091	7.3	3p2o:A, 3p2o:B
13	7wae:B	877	18	0.1587	0.0114	0.5556	7.3	7wad:A, 7wad:B, 7wad:C, 7wad:D, 7wae:D, 7wae:A, 7wae:C, 7waf:A, 7waf:C, 7waf:D, 7waf:B

[Back]