AQWVPRVDIKEEVNHFVLYADLPGIDPSQIEVQMDKGILSIRGERKSESSTETERFSRIERRYGSFHRRFALPDSADADG
ITAAGRNGVLEIRIPKR
The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3gla:B | 99 | 96 | 0.9897 | 0.9697 | 1.0000 | 3.31e-67 | 3gla:A |
2 | 5zs3:A | 113 | 89 | 0.2887 | 0.2478 | 0.3146 | 5.13e-09 | 5zs6:A |
3 | 7oa6:B | 152 | 96 | 0.3299 | 0.2105 | 0.3333 | 4.10e-07 | 7oa6:I |
4 | 4yl9:D | 123 | 97 | 0.3299 | 0.2602 | 0.3299 | 2.11e-05 | |
5 | 3l1e:A | 105 | 90 | 0.2165 | 0.2000 | 0.2333 | 0.003 | |
6 | 3vqm:A | 111 | 93 | 0.2887 | 0.2523 | 0.3011 | 0.009 | 3vqm:B, 3vqm:C, 3vqm:E, 3vqm:F, 3vqm:I, 3vqm:K, 3vqm:M, 3vqm:N |
7 | 5lum:A | 78 | 81 | 0.2371 | 0.2949 | 0.2840 | 0.15 | 5lum:B, 5lum:D, 5lum:C, 5lum:E |
8 | 6ei1:A | 335 | 23 | 0.1031 | 0.0299 | 0.4348 | 2.2 | |
9 | 7m4u:d | 207 | 55 | 0.1649 | 0.0773 | 0.2909 | 6.6 | 7m4w:d, 7m4x:d, 7m4y:d, 7m4z:d, 7ryf:d, 7ryg:d, 7ryh:d, 7uvv:d, 7uvw:d, 7uvx:d, 7uvy:d, 7uvz:d, 7uw1:d, 6v39:d, 6v3a:d, 6v3b:d, 6v3e:d, 6ypu:e, 6yt9:e |
10 | 4rjw:A | 426 | 45 | 0.1237 | 0.0282 | 0.2667 | 7.2 | 4rjx:A |
11 | 4a48:B | 69 | 25 | 0.0722 | 0.1014 | 0.2800 | 8.2 | 4a48:A, 4a4j:A, 2xmw:A |
12 | 7xx4:A | 395 | 21 | 0.0825 | 0.0203 | 0.3810 | 9.2 | 2iyf:A, 2iyf:B, 4m83:A, 4m83:B, 7xx4:B |
13 | 8c8v:A | 1032 | 29 | 0.1340 | 0.0126 | 0.4483 | 9.3 | 8c8u:A, 8c8w:A, 8c9d:A |