AQTINLQLEGMDCTSCASSIERAIAKVPGVQSCQVNFALEQAVVSYHGETTPQILTDAVERAGYHARVL
The query sequence (length=69) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4a48:B | 69 | 69 | 1.0000 | 1.0000 | 1.0000 | 4.40e-47 | 4a48:A, 4a4j:A, 2xmw:A |
2 | 1kqk:A | 80 | 64 | 0.3623 | 0.3125 | 0.3906 | 2.20e-11 | |
3 | 1oq6:A | 76 | 65 | 0.3478 | 0.3158 | 0.3692 | 9.02e-11 | |
4 | 1afj:A | 72 | 68 | 0.3623 | 0.3472 | 0.3676 | 1.01e-09 | |
5 | 1mwz:A | 73 | 63 | 0.3333 | 0.3151 | 0.3651 | 1.91e-09 | |
6 | 1kvj:A | 79 | 68 | 0.3188 | 0.2785 | 0.3235 | 1.27e-08 | 3cjk:B, 2k1r:A, 5t7l:B |
7 | 1fvs:A | 72 | 69 | 0.2464 | 0.2361 | 0.2464 | 4.62e-07 | 2ggp:B |
8 | 6ff2:A | 67 | 60 | 0.3188 | 0.3284 | 0.3667 | 6.14e-07 | 6ff2:B |
9 | 1k0v:A | 73 | 60 | 0.2754 | 0.2603 | 0.3167 | 8.21e-07 | 3i9z:A, 2qif:A, 2qif:B |
10 | 6a71:B | 71 | 68 | 0.3623 | 0.3521 | 0.3676 | 1.20e-06 | 6a72:A |
11 | 1s6u:A | 76 | 44 | 0.2464 | 0.2237 | 0.3864 | 2.53e-06 | |
12 | 8ioy:A | 816 | 64 | 0.2899 | 0.0245 | 0.3125 | 6.68e-06 | |
13 | 1yjt:A | 75 | 62 | 0.2754 | 0.2533 | 0.3065 | 3.94e-05 | 1yjv:A |
14 | 7si6:A | 873 | 65 | 0.3333 | 0.0263 | 0.3538 | 1.04e-04 | 7si3:A, 7si7:A |
15 | 7si6:A | 873 | 64 | 0.2754 | 0.0218 | 0.2969 | 6.74e-04 | 7si3:A, 7si7:A |
16 | 1y3j:A | 77 | 65 | 0.2754 | 0.2468 | 0.2923 | 1.17e-04 | |
17 | 3dxs:X | 74 | 73 | 0.2899 | 0.2703 | 0.2740 | 0.14 | |
18 | 6rm3:SNN | 167 | 58 | 0.2464 | 0.1018 | 0.2931 | 0.90 | |
19 | 8ghh:A | 276 | 35 | 0.1884 | 0.0471 | 0.3714 | 0.95 | 8ghi:A |
20 | 8q74:A | 783 | 61 | 0.2174 | 0.0192 | 0.2459 | 1.0 | 8q75:A, 8q76:A |
21 | 7zel:A | 827 | 45 | 0.2464 | 0.0206 | 0.3778 | 1.4 | 7zel:B, 7zep:B, 7zes:A, 7zes:B |
22 | 6yhs:P | 92 | 50 | 0.1739 | 0.1304 | 0.2400 | 1.7 | 7m4v:S, 7m4w:S, 7m4x:S, 7m4y:S, 7m4z:S, 7ryf:S, 7ryg:S, 7ryh:S, 7uvv:S, 7uvw:S, 7uvx:S, 7uvy:S, 7uvz:S, 7uw1:S, 6v39:S, 6v3a:S, 6v3b:S, 6v3d:S, 6ysi:P |
23 | 4v8p:BC | 409 | 19 | 0.1304 | 0.0220 | 0.4737 | 4.2 | 4v8p:CC, 4v8p:EC, 4v8p:GC |
24 | 3gla:B | 99 | 25 | 0.1014 | 0.0707 | 0.2800 | 6.1 | 3gla:A |
25 | 2p1n:B | 571 | 51 | 0.1884 | 0.0228 | 0.2549 | 8.0 | 3c6n:B, 3c6o:B, 3c6p:B, 2p1m:B, 2p1n:E, 2p1o:B, 2p1p:B, 2p1q:B |
26 | 1ee8:A | 266 | 25 | 0.1159 | 0.0301 | 0.3200 | 8.1 | 1ee8:B |
27 | 4y2i:A | 65 | 64 | 0.1739 | 0.1846 | 0.1875 | 8.6 | |
28 | 5goo:A | 447 | 31 | 0.1884 | 0.0291 | 0.4194 | 9.5 | 5goo:B, 5goo:C, 5gop:A, 5gop:C, 5gop:B, 5goq:A, 5goq:B, 5goq:C |