AQHYAQAIHHEGLARHHTTVAEDHRQTANLHDNRIKAAKARYNAGLDPNGLTSAQKHQIERDHHLSLAAQAERHAATHNR
EAAYHRLHS
The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5los:A | 89 | 89 | 1.0000 | 1.0000 | 1.0000 | 2.21e-58 | |
2 | 2aly:B | 785 | 48 | 0.1910 | 0.0217 | 0.3542 | 1.8 | 2amc:B, 1eiy:B, 3hfz:B, 2iy5:B, 1jjc:B, 3teh:B, 4tva:B |
3 | 7pbg:A | 525 | 48 | 0.1461 | 0.0248 | 0.2708 | 1.8 | 7pbg:B, 7pbi:A, 7pbi:B, 7pbi:C, 7pbi:D, 7pbi:E, 7pbi:F, 7pbi:G, 7pbi:H |
4 | 1igt:B | 444 | 16 | 0.1011 | 0.0203 | 0.5625 | 6.6 | 1igt:D, 2otu:B, 2otu:D, 2otu:F, 2otu:H, 2otw:B, 2otw:D, 2qhr:H, 6uqc:C, 6uqc:D, 6uqc:F, 5vaa:A, 5vaa:B, 3zo0:A |
5 | 8bam:A | 525 | 48 | 0.1573 | 0.0267 | 0.2917 | 6.6 | 8bam:B, 8bap:A, 8bap:B, 8bap:C, 8bap:D, 8bap:E, 8bap:F, 8bap:G, 8bap:H, 8bap:I, 8bap:J, 8bap:K, 8bap:L, 8bap:M, 8bap:N, 8bap:O, 8bap:P, 5fxd:A, 5fxd:B, 5fxe:A, 5fxe:B, 5fxf:A, 5fxf:B, 5fxp:A, 5fxp:B, 7ywu:A, 7ywu:B, 7ywu:C, 7ywu:D, 7ywu:E, 7ywu:F, 7ywu:G, 7ywu:H, 7ywv:A, 7ywv:B, 7ywv:C, 7ywv:D, 7ywv:E, 7ywv:F, 7ywv:G, 7ywv:H |
6 | 3c37:A | 223 | 17 | 0.1011 | 0.0404 | 0.5294 | 7.6 | 3c37:B |