BioLiP

>protein
AQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQ
VKKTDFEVFDALMVDSQKCSDVSEPGPYHQEPYVCKRFAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALS
IKDGVMVLSATHRYKKKYVTTLLYKPI

The query sequence (length=187) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7myj:D	187	187	1.0000	1.0000	1.0000	1.77e-141	6b1u:B, 6b1u:D, 8bik:B, 8bik:E, 6c9f:B, 6c9g:B, 6c9j:B, 4cfe:B, 4cfe:D, 4cff:B, 4cff:D, 5ezv:B, 5ezv:D, 5iso:B, 5iso:D, 7myj:B, 4yef:A, 4yef:B, 4yef:C, 4yef:D, 4yef:E, 4yef:F, 4yef:G, 1z0m:A, 1z0m:B, 1z0m:C, 1z0n:A, 1z0n:B, 1z0n:C, 4zhx:B, 4zhx:D
2	6c9h:B	168	187	0.8824	0.9821	0.8824	3.84e-118	6e4t:B, 6e4u:B, 6e4w:B, 5kq5:B, 4qfr:B, 4qfs:B, 5t5t:B, 5ufu:B
3	6b2e:B	193	188	0.7861	0.7617	0.7819	3.87e-104	4cfh:B, 4rer:B, 4yee:A, 4yee:G, 4yee:B, 4yee:C, 4yee:D, 4yee:N, 4yee:E, 4yee:F, 4yee:H, 4yee:I, 4yee:J, 4yee:K, 4yee:L, 4yee:M, 4yee:O, 4yee:P, 4yee:Q, 4yee:R
4	2qrd:D	92	57	0.1604	0.3261	0.5263	1.70e-14	2qr1:B, 2qr1:D, 2qrc:B, 2qrc:D, 2qrd:B
5	4pyh:A	293	73	0.1444	0.0922	0.3699	3.47e-07
6	8dl1:A	713	51	0.0909	0.0238	0.3333	0.45	8dge:A, 8dge:B, 8dge:C, 8dge:D, 8dl1:B, 8dl1:C, 8dl1:D, 8dl2:A, 8dl2:B, 8dl2:C, 8dl2:D
7	7p43:B	690	44	0.0588	0.0159	0.2500	6.0	7p43:A
8	5kdi:A	211	49	0.0856	0.0758	0.3265	6.5	5kdi:B
9	7esn:A	435	31	0.0642	0.0276	0.3871	9.6	7esk:A, 7esm:A, 8i4d:A, 7yqs:A

[Back]