APTSSIEIVLDKTTASVGEIVTASINIKNITNFSGCQLNMKYDPAVLQPVTSSGVAYTKSTMPGAGTILNSDFNLRQVAD
NDLEKGILNFSKAYVSLDDYRTAAAPEQTGTVAVVKFKVLKEETSSISFEDTTSVPNAIDGTVLFDWNGDRIQSGYSVIQ
PAVINLDMIKAS
The query sequence (length=172) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3l8q:A | 338 | 172 | 0.9942 | 0.5059 | 0.9942 | 1.23e-121 | 3fnk:B, 3fnk:C, 3l8q:C, 1zv9:A |
2 | 3l8q:A | 338 | 164 | 0.4826 | 0.2456 | 0.5061 | 5.96e-51 | 3fnk:B, 3fnk:C, 3l8q:C, 1zv9:A |
3 | 4usr:A | 357 | 88 | 0.1686 | 0.0812 | 0.3295 | 4.2 | |
4 | 1a47:A | 683 | 37 | 0.0698 | 0.0176 | 0.3243 | 4.3 | 3bmv:A, 3bmw:A, 1ciu:A |
5 | 7nut:A | 401 | 63 | 0.0872 | 0.0374 | 0.2381 | 5.5 | 7nut:B, 7nuu:A, 7nuu:B |