APSVDPTKVIFYQKKNFEGSGDTYAVGQDVSVPGSLNDKYFSVAVGASAKVIAWQHYNETGHYREWTTSQADISDIGGLS
RFRVVDDDTR
The query sequence (length=90) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5z6e:A | 90 | 90 | 1.0000 | 1.0000 | 1.0000 | 3.00e-63 | |
2 | 2b1o:A | 212 | 92 | 0.3444 | 0.1462 | 0.3370 | 3.16e-07 | |
3 | 3gma:B | 566 | 82 | 0.2667 | 0.0424 | 0.2927 | 0.009 | 3gf3:A, 3glm:A, 3glm:C, 3glm:B, 3glm:D, 3gma:A |
4 | 8btd:LC | 315 | 35 | 0.1333 | 0.0381 | 0.3429 | 0.50 | 8br8:LC, 8brm:LC, 8bsi:LC, 8bsj:LC, 8btr:LC, 8fru:C, 7pwg:C, 7pwo:C2 |
5 | 4b28:A | 437 | 21 | 0.0889 | 0.0183 | 0.3810 | 2.8 | |
6 | 4v4n:BH | 215 | 51 | 0.2000 | 0.0837 | 0.3529 | 3.1 | 5jb3:H, 5jbh:H, 6sw9:H, 6swc:H, 6swe:H, 4v6u:AH, 7zag:H, 7zah:H, 7zai:H, 7zhg:H |
7 | 6kih:A | 400 | 57 | 0.1444 | 0.0325 | 0.2281 | 4.3 | 6kih:C, 6kih:D, 6kih:E, 6kih:F, 6kih:H, 6kih:I, 6kih:K, 6kih:L, 6kih:B, 6kih:G, 6kih:J |