APPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEA
The query sequence (length=70) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1jgn:A | 98 | 70 | 1.0000 | 0.7143 | 1.0000 | 9.05e-46 | 7bn3:C, 7bn3:A, 7bn3:B, 1jh4:A, 3ktp:A, 3ktr:A, 3kui:A, 3kuj:A, 3kus:A, 3kus:B, 3kut:A, 3kut:B, 3pkn:A, 3pth:A, 2rqg:B, 2rqh:B, 8smo:A, 8smo:C, 8smo:E, 8smo:G, 8smo:I, 8smo:K, 8smo:M, 8smo:O, 2x04:A, 2x04:B |
2 | 3ntw:A | 61 | 58 | 0.4429 | 0.5082 | 0.5345 | 7.29e-14 | 3ntw:C |
3 | 6h7b:A | 78 | 65 | 0.4286 | 0.3846 | 0.4615 | 4.13e-13 | 6h7b:C |
4 | 3ppu:A | 314 | 51 | 0.2286 | 0.0510 | 0.3137 | 0.24 | |
5 | 6nlx:C | 335 | 42 | 0.2000 | 0.0418 | 0.3333 | 2.2 | 6nlx:B, 6nlx:D, 5ur0:A, 5ur0:B, 5ur0:C, 5ur0:D |
6 | 1tec:E | 279 | 21 | 0.1429 | 0.0358 | 0.4762 | 3.4 | 2tec:E, 3tec:E, 1thm:A |
7 | 4rtl:A | 254 | 60 | 0.2714 | 0.0748 | 0.3167 | 3.4 | 2g1p:A, 2g1p:B, 4gbe:D, 4gbe:E, 4gbe:F, 4gol:D, 4gol:E, 4gol:F, 4gom:D, 4gom:E, 4gom:F, 4gon:D, 4gon:E, 4gon:F, 4goo:D, 4goo:E, 4goo:F, 2ore:D, 2ore:E, 2ore:F, 4rtj:A, 4rtk:A, 4rtm:A, 4rtn:A, 4rto:A, 4rtp:A, 4rtq:A, 4rtr:A, 4rts:A |
8 | 5ci5:A | 393 | 23 | 0.1571 | 0.0280 | 0.4783 | 6.6 | 5ci5:B |
9 | 6l1h:B | 305 | 43 | 0.2000 | 0.0459 | 0.3256 | 7.8 | 6l1h:A |
10 | 3fn0:H | 221 | 29 | 0.1429 | 0.0452 | 0.3448 | 9.8 |