APMITCRVCQSLINVEGKMHQHVVKCGVCNEATPIKNAPPGKKYVRCPCNSLLIAKVTSQRIACPRPYCKRIINLGPVHP
G
The query sequence (length=81) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8oqh:A | 81 | 81 | 1.0000 | 1.0000 | 1.0000 | 9.89e-55 | 8oqh:B |
2 | 1khw:B | 497 | 42 | 0.1728 | 0.0282 | 0.3333 | 0.47 | 1khw:A |
3 | 1iru:B | 233 | 19 | 0.0988 | 0.0343 | 0.4211 | 4.7 | 8bzl:O, 8bzl:A, 1iru:P |
4 | 1ici:A | 256 | 45 | 0.1728 | 0.0547 | 0.3111 | 5.3 | 1ici:B, 1m2g:A, 1m2h:A, 1m2j:A, 1m2k:A, 1m2n:A, 1m2n:B, 4twi:A |
5 | 2g2r:L | 219 | 17 | 0.1111 | 0.0411 | 0.5294 | 5.8 | 2g2r:A |
6 | 7zke:E | 1623 | 37 | 0.1481 | 0.0074 | 0.3243 | 8.0 | |
7 | 3pmq:A | 593 | 34 | 0.1235 | 0.0169 | 0.2941 | 8.3 | |
8 | 4j9w:A | 310 | 25 | 0.1358 | 0.0355 | 0.4400 | 8.9 | 4j9w:B, 4j9x:A, 4j9x:B |