APGQKECDNALRQLETVRELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGDAIATASKALCGF
TEAAAQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAKHTSALCNSCRLASART
ANPTAKRQFVQSAKEVANSTANLVKTIKALDGDFTEENRAQCRAATAPLLEAVDNLSAFASNPEFSSVPAQISPEGRAAM
EPIVISAKTMLESAGGLIQTARALAVNPRDPPRWSVLAGHSRTVSDSIKKLITSMRDKAPG
The query sequence (length=301) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6twn:B | 309 | 299 | 0.9934 | 0.9676 | 1.0000 | 0.0 | 5fzt:A, 6twn:A, 7v1a:A, 4w8p:A, 7zw4:A |
2 | 8ivz:A | 165 | 98 | 0.3256 | 0.5939 | 1.0000 | 3.62e-67 | 8ivz:B |
3 | 8ivz:A | 165 | 68 | 0.2259 | 0.4121 | 1.0000 | 1.04e-41 | 8ivz:B |
4 | 8acf:H | 219 | 73 | 0.0797 | 0.1096 | 0.3288 | 0.045 | 8aci:H |
5 | 6vg1:A | 642 | 65 | 0.0598 | 0.0280 | 0.2769 | 3.7 | 6vg1:B |
6 | 5y6p:ka | 273 | 35 | 0.0465 | 0.0513 | 0.4000 | 4.1 | 5y6p:kb |
7 | 3na8:A | 291 | 83 | 0.0831 | 0.0859 | 0.3012 | 5.4 | 3na8:B, 3na8:C, 3na8:D |
8 | 6qkb:A | 384 | 48 | 0.0664 | 0.0521 | 0.4167 | 6.1 | 6qkb:B |
9 | 5huq:A | 433 | 171 | 0.1196 | 0.0831 | 0.2105 | 6.1 | 6c1w:A, 6c1w:B, 6c1w:C, 8ezf:B, 8ezh:B, 8ezi:B, 5huq:B |
10 | 6igz:3 | 226 | 60 | 0.0465 | 0.0619 | 0.2333 | 6.8 | |
11 | 3owo:A | 382 | 120 | 0.0997 | 0.0785 | 0.2500 | 8.7 | 3owo:B, 3owo:C, 3owo:D, 3ox4:A, 3ox4:B, 3ox4:C, 3ox4:D |
12 | 4l80:C | 347 | 130 | 0.0997 | 0.0865 | 0.2308 | 9.1 | 6kkh:C, 6kkh:F, 6kkh:I, 6kkh:L, 4l80:A, 4l80:B, 4l80:D, 4l80:F, 4l80:E |