BioLiP

>protein
APGDIEDMIKAGIPGARVTIRDLAGDGDHYAAEVVAEAFRGKTRVQQHQMVYNALKGNMGGILHALALQTSAPE

The query sequence (length=74) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5nfm:A	75	74	1.0000	0.9867	1.0000	3.09e-50	5nfl:A
2	3tr3:B	81	71	0.3784	0.3457	0.3944	2.75e-13	3tr3:A
3	2ihv:A	563	23	0.1622	0.0213	0.5217	1.1	2iht:A, 2iht:B, 2iht:C, 2iht:D, 2ihu:A, 2ihu:B, 2ihu:C, 2ihu:D, 2ihv:B, 2ihv:C, 2ihv:D, 1upa:A, 1upa:B, 1upa:C, 1upa:D, 1upb:A, 1upb:B, 1upb:C, 1upb:D, 1upc:A, 1upc:B, 1upc:C, 1upc:D, 1upc:E, 1upc:F
4	8rwj:D	676	69	0.2432	0.0266	0.2609	3.0	8rwj:I, 8rwj:A, 8rwj:B, 8rwj:C, 8rwj:E, 8rwj:F, 8rwj:G, 8rwj:H, 1ry2:A
5	5f55:A	705	46	0.1757	0.0184	0.2826	3.7	5f54:A, 5f56:A, 6lrd:A
6	5mrc:NN	115	43	0.2027	0.1304	0.3488	8.4	8d8k:N, 8d8l:N, 5mre:NN, 5mrf:NN, 8om2:N, 8om3:N, 8om4:N
7	2x7f:A	276	30	0.1081	0.0290	0.2667	8.5	5ax9:B, 2x7f:D, 2x7f:E
8	6ra7:A	302	30	0.1081	0.0265	0.2667	8.9	5ax9:A, 5ax9:C, 5d7a:A, 5d7a:B, 5d7a:C, 5di1:A, 5j95:A, 4obp:A, 6ra5:A, 4rvt:A, 4u40:A, 4u42:A, 4u43:A, 4u44:A, 4u45:A, 5w5q:A, 8wm0:A, 2x7f:B, 2x7f:C, 7xzq:A, 7xzr:A, 7xzr:B, 4zk5:A, 4zp5:A
9	7f8h:C	262	50	0.2027	0.0573	0.3000	9.7	4egc:B, 7f8g:B, 7f8g:A, 7f8h:B, 7f8h:A, 3geb:A, 3geb:B, 3geb:C, 3geb:D, 3hb0:A, 3hb0:B, 3hb0:C, 3hb0:D, 3hb1:A, 3hb1:B, 3hb1:C, 3hb1:D, 5zma:B, 5zma:A, 5zma:C
10	3efv:A	459	36	0.1757	0.0283	0.3611	9.8	3efv:B, 3efv:C, 3efv:D

[Back]