APEEERIKYVITVVEQIAKDAHRNGQEELAKLAERTAEEAKKATERGEEETLRIVYVIVVVLQIALEAHRNGQEELAKLA
LRTAEEAIKATERGEEETLRIVYVIVVVLQIALEAHRNGQEELAKLALRTAEEAIKATERGEEETLRIVYVIVVVLQIAL
EAHRNGQEELAKLALRTAEEAIKATERGEEETLRIVYVIVVVLQIALEAHRNGQEELAKLALRTAEEAIKATERGEEETE
RIVYDIVVVLQEALEAHRNGEEERAKKALDEARRRIEATE
The query sequence (length=280) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7udm:B | 281 | 279 | 0.9964 | 0.9929 | 1.0000 | 0.0 | 7udl:A, 7udm:A |
2 | 7udm:B | 281 | 230 | 0.7536 | 0.7509 | 0.9174 | 3.05e-121 | 7udl:A, 7udm:A |
3 | 7udj:H | 192 | 179 | 0.2964 | 0.4323 | 0.4637 | 3.01e-22 | |
4 | 7udj:H | 192 | 177 | 0.2857 | 0.4167 | 0.4520 | 5.78e-20 | |
5 | 7udj:H | 192 | 172 | 0.2750 | 0.4010 | 0.4477 | 6.61e-20 | |
6 | 7udj:H | 192 | 133 | 0.2214 | 0.3229 | 0.4662 | 1.18e-12 |