Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
APAEDGYNWRKYGQKLVKGSEYPRSYYKCTNPNCQVKKKVERSREGHITEIIYKGAHNHLKPL

The query sequence (length=63) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 6j4f:B 63 63 1.0000 1.0000 1.0000 6.43e-43 6j4f:F
2 6j4g:B 58 58 0.7619 0.8276 0.8276 3.45e-30
3 7d11:A 79 60 0.6190 0.4937 0.6500 1.86e-26 6j4e:B
4 1wj2:A 71 60 0.5556 0.4930 0.5833 1.75e-19 2lex:A
5 2ayd:A 76 63 0.5873 0.4868 0.5873 2.01e-19
6 7z0r:A 81 62 0.4762 0.3704 0.4839 1.76e-16 7z0r:B, 7z0u:A
7 8k31:B 79 60 0.5238 0.4177 0.5500 5.01e-16
8 8iex:A 88 57 0.4603 0.3295 0.5088 3.08e-12
9 5w3x:D 73 62 0.4127 0.3562 0.4194 1.34e-11 7p8k:B, 5w3x:B
10 6ir8:A 69 59 0.3175 0.2899 0.3390 6.91e-08
11 8ity:V 361 42 0.2222 0.0388 0.3333 3.7 8iue:V, 8iuh:V, 5n9g:A, 5n9g:F, 4roc:A, 4rod:A, 4roe:A
12 6xu6:CU 96 42 0.1905 0.1250 0.2857 3.8 6xu7:CU
13 3vo2:A 296 25 0.1429 0.0304 0.3600 4.6 3vo1:A, 3vo1:B, 3vo2:B
14 4tlg:A 396 30 0.1905 0.0303 0.4000 5.8 4tlg:B
15 6nwz:A 665 20 0.1270 0.0120 0.4000 6.2
16 7eu0:I 113 23 0.1270 0.0708 0.3478 7.6 7eu1:I, 8xmb:I, 8xmc:I, 8xmd:I, 8xme:I
17 8hil:I 99 23 0.1270 0.0808 0.3478 8.7 8him:I, 8hyj:I
18 8tzc:A 872 28 0.1587 0.0115 0.3571 9.8

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218