BioLiP

>protein
APADSLYSRMGGEAAVEKAVDVFYERIVADPQLAPFFANVDMKKQRRKQVAFMTYVFGGSGAYEGRDLGASHRRLIREQG
MNHHHFDLVAAHLDSTLQELGVAQELKAEAMAIVASARPLIFG

The query sequence (length=123) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4xdi:A	127	123	1.0000	0.9685	1.0000	3.56e-88	6cii:A, 4xdi:B
2	1dly:A	121	119	0.4472	0.4545	0.4622	3.15e-34	1uvx:A
3	2hz1:A	123	112	0.4309	0.4309	0.4732	9.85e-34	2hz2:A, 2hz3:A, 1mwb:A, 1rtx:A, 1s69:A, 1s6a:A
4	2ksc:A	123	114	0.4228	0.4228	0.4561	1.48e-31	4l2m:A, 4l2m:B, 4max:A, 4max:B, 4max:C
5	6bme:A	127	116	0.4228	0.4094	0.4483	5.90e-27	6bme:B
6	3aq5:A	117	121	0.3415	0.3590	0.3471	4.55e-24	3aq5:B, 3aq6:A, 3aq6:B, 3aq7:A, 3aq7:B, 3aq8:A, 3aq8:B, 3aq9:A, 3aq9:B
7	1s56:B	135	111	0.3333	0.3037	0.3694	1.58e-20	5ab8:A, 2gkm:A, 2gkm:B, 2gkn:A, 2gkn:B, 2gl3:A, 2gl3:B, 2gln:A, 2gln:B, 1idr:A, 1idr:B, 1rte:A, 1rte:B, 1s56:A, 1s61:A, 1s61:B
8	1dlw:A	116	114	0.3333	0.3534	0.3596	1.11e-19	1uvy:A
9	6td7:A	126	119	0.3089	0.3016	0.3193	3.16e-18
10	5d1v:A	121	111	0.2846	0.2893	0.3153	3.12e-09	5d1v:B
11	2bkm:A	128	59	0.1951	0.1875	0.4068	6.72e-09	2bkm:B
12	5v3u:A	131	57	0.1707	0.1603	0.3684	9.29e-08	5v3t:A, 5v3t:B, 5v3u:B, 5v3v:A, 5v3v:B
13	1ux8:A	118	52	0.1707	0.1780	0.4038	3.00e-07
14	8tls:A	116	119	0.2276	0.2414	0.2353	1.43e-05	8tls:B, 7tt9:A, 7tt9:B, 7tt9:C, 7tt9:D, 8ugz:A, 8ugz:B, 8ugz:C, 8ugz:D, 8uzu:A, 8uzu:B, 8uzu:C, 8uzu:D, 8vij:A, 8vij:B, 8vij:C, 8vij:D, 8vsh:A, 8vsh:B, 8vsh:C, 8vsh:D, 8w3a:A, 8w3a:B, 8w3a:C, 8w3a:D
15	4uzv:A	129	99	0.2195	0.2093	0.2727	1.52e-04	2bmm:A
16	2ig3:A	127	63	0.1382	0.1339	0.2698	0.016	2ig3:B
17	1tu9:A	131	76	0.2033	0.1908	0.3289	0.73
18	6bwd:A	771	57	0.1220	0.0195	0.2632	1.2	6bwd:B, 6bwd:D, 6bwd:C
19	4nfu:A	619	56	0.1463	0.0291	0.3214	3.2	7xey:A
20	2gqk:A	173	84	0.1707	0.1214	0.2500	4.4	2ggt:A, 2ggt:B, 2gql:A, 2gqm:A, 2gt6:A, 2hrf:A, 2hrn:A
21	7xjp:A	580	52	0.1545	0.0328	0.3654	4.9
22	1ngk:B	127	59	0.1138	0.1102	0.2373	5.5	1ngk:A, 1ngk:C, 1ngk:D, 1ngk:E, 1ngk:F, 1ngk:G, 1ngk:H, 1ngk:I, 1ngk:J, 1ngk:K, 1ngk:L, 2qrw:A, 2qrw:B, 2qrw:C, 2qrw:D, 2qrw:E, 2qrw:F, 2qrw:G, 2qrw:H, 2qrw:I, 2qrw:J, 2qrw:K, 2qrw:L
23	8uhe:K	593	40	0.1138	0.0236	0.3500	5.8
24	2xyk:B	130	61	0.1463	0.1385	0.2951	6.7	2xyk:A
25	5um2:A	316	46	0.1301	0.0506	0.3478	7.2
26	6is1:B	121	67	0.1301	0.1322	0.2388	7.5	6is1:A, 6is1:C, 6is1:D, 6is1:E, 6is1:F, 6is1:G, 6is1:H, 6is2:A, 6is2:B, 6is2:C, 6is2:D, 6is3:C
27	1q2l:A	937	24	0.0813	0.0107	0.4167	8.5

[Back]