ANPSDPAVQRIIDVTKPSRSNIKTTLIEDVEPLMHSIAAGVEFIEVYGSDSSPFPSELLDLCGRQNIPVRLIDSSIVNQL
FKGERKAKTFGIARVPRPARFGDIASRRGDVVVLDGVKIVGNIGAIVRTSLALGASGIILVDSDITSIADRRLQRASRGY
VFSLPVVLSGREEAIAFIRDSGMQLMTLKADGDISVKELGDNPDRLALLFGSEKGGPSDLFEEASSASVSIPMMSQTESL
NVSVSLGIALHERIDRNLAAN
The query sequence (length=261) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3gyq:A | 261 | 261 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 3gyq:B |
2 | 3nk7:B | 267 | 258 | 0.7471 | 0.7303 | 0.7558 | 4.35e-138 | 3nk7:A |
3 | 5kzk:A | 262 | 152 | 0.2069 | 0.2061 | 0.3553 | 7.71e-17 | 5kzk:B, 5l0z:A, 5l0z:B |
4 | 4x3l:A | 260 | 169 | 0.2031 | 0.2038 | 0.3136 | 4.39e-14 | 4x3l:B, 4x3m:A, 4x3m:B |
5 | 1x7p:A | 265 | 154 | 0.1839 | 0.1811 | 0.3117 | 4.59e-07 | 1x7p:B |
6 | 6yxy:EF | 302 | 168 | 0.1801 | 0.1556 | 0.2798 | 3.26e-06 | 6yxx:EF |
7 | 1v2x:A | 191 | 149 | 0.1571 | 0.2147 | 0.2752 | 8.45e-06 | |
8 | 4pzk:A | 159 | 143 | 0.1456 | 0.2390 | 0.2657 | 1.39e-05 | 4pzk:B |
9 | 2ha8:A | 159 | 146 | 0.1494 | 0.2453 | 0.2671 | 1.91e-05 | 2ha8:B |
10 | 7edc:A | 236 | 163 | 0.1724 | 0.1907 | 0.2761 | 9.64e-05 | |
11 | 5co4:B | 161 | 146 | 0.1609 | 0.2609 | 0.2877 | 1.31e-04 | 5co4:A |
12 | 7oi6:1 | 257 | 146 | 0.1226 | 0.1245 | 0.2192 | 0.034 | 7oi6:z |
13 | 8w9u:A | 152 | 142 | 0.1341 | 0.2303 | 0.2465 | 0.23 | 8w9u:B |
14 | 1mxi:A | 156 | 148 | 0.1494 | 0.2500 | 0.2635 | 0.31 | |
15 | 6yxy:EE | 433 | 64 | 0.0766 | 0.0462 | 0.3125 | 0.41 | 7aoi:XO, 6yxx:EE |
16 | 4jal:A | 156 | 144 | 0.1264 | 0.2115 | 0.2292 | 0.41 | 4jal:B |
17 | 6tej:B | 585 | 87 | 0.1188 | 0.0530 | 0.3563 | 1.2 | |
18 | 7e3q:B | 159 | 140 | 0.1456 | 0.2390 | 0.2714 | 1.6 | |
19 | 3dd7:A | 123 | 73 | 0.0766 | 0.1626 | 0.2740 | 2.0 | 3dd7:C |
20 | 3n4k:A | 163 | 149 | 0.1303 | 0.2086 | 0.2282 | 2.3 | |
21 | 4aqh:B | 383 | 24 | 0.0383 | 0.0261 | 0.4167 | 2.6 | 1a7c:A, 4aqh:A, 4aqh:C, 7aqf:A, 7aqg:A, 1dvm:A, 1dvm:C, 1dvm:D, 4g8o:D, 4g8r:A, 4g8r:B, 4ic0:A, 4ic0:C, 3q02:A, 3q02:B, 3q03:A, 3q03:B, 3r4l:A, 3ut3:B |
22 | 4h3s:A | 585 | 111 | 0.1073 | 0.0479 | 0.2523 | 3.8 | |
23 | 1nb3:I | 98 | 55 | 0.0575 | 0.1531 | 0.2727 | 6.7 | 1nb3:J, 1nb3:K, 1nb3:L, 1nb5:I, 1nb5:J, 1nb5:K, 1nb5:L |
24 | 3etn:B | 198 | 40 | 0.0575 | 0.0758 | 0.3750 | 8.0 | 3etn:A, 3etn:C, 3etn:D |
25 | 4yiv:A | 374 | 63 | 0.0651 | 0.0455 | 0.2698 | 8.3 | |
26 | 4xbo:A | 228 | 151 | 0.1226 | 0.1404 | 0.2119 | 9.1 | 4cne:A, 4cne:B, 4xbo:B |