ANPEELGKVVTAIEQLDQMRIGLASTLEGGTSEPTLDTFKAVCAPVGKQAKEIAAANGWQVRQVALKYRNPNHAPRTALD
VQALNQFDNNHHLQAFWQTDKEGVHYFRRIDVQASCLACHGAKNRRPAFIQEKYPSDRAYGFRVGDLRGMYAVTIPQIQQ
A
The query sequence (length=161) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5b82:A | 161 | 161 | 1.0000 | 1.0000 | 1.0000 | 1.62e-121 | |
2 | 6bdq:A | 259 | 30 | 0.0807 | 0.0502 | 0.4333 | 1.9 | 6b4x:A, 6b4y:A, 6b4z:A, 6b50:A, 6bdp:A, 6bdr:A, 6bds:A, 5byj:A, 5byk:A, 8e5q:A, 8e5r:A, 6mfe:A, 4mua:A, 4mub:A, 6uux:A |
3 | 4wuv:A | 280 | 43 | 0.0745 | 0.0429 | 0.2791 | 5.1 | 4wuv:B |
4 | 6aa8:E | 281 | 40 | 0.0807 | 0.0463 | 0.3250 | 5.1 | 6aa8:F |
5 | 4kug:A | 282 | 40 | 0.0807 | 0.0461 | 0.3250 | 5.5 | 4kug:B, 4kug:C, 4kug:D, 4kuh:A, 4kuh:B, 4kuh:C, 4kuh:D, 4kuh:E, 4kuh:F, 4kuh:G, 4kuh:H |
6 | 8yts:A | 83 | 28 | 0.0621 | 0.1205 | 0.3571 | 5.9 | 8yts:B |
7 | 5y3m:A | 738 | 65 | 0.1118 | 0.0244 | 0.2769 | 8.5 | 3wpe:A, 5y3m:B |
8 | 3g8r:B | 336 | 27 | 0.0497 | 0.0238 | 0.2963 | 8.6 |