ANFIAEFFGHRVYPEVVSTEAARNDQATGTCPFLTAAKLVETSCVKAETSRGVCVVNTAVDNERYDWLVCPNRALDPLFM
SAASRKLFGYGPTEPLQFIAAPTLADQAVRDGIREWLDRGVHVVAYFQEKLGGELSISKTDSSPEFSFDWTLAEVESIYP
VPKIKRYGVLEIQTMDFHGSYKHAVGAIDIALVEGIDFHGWLPTPAGRAALSKKMEGPNLSNVFKRTFYQMAYKFALSGH
QRCAGTGFAIPQSVWKSWLRHLANPTLIDNGDGTFSLGDTRNDSENAWIFVFELDPDTDASPRPLAPHLEIRVNVDTLID
LALRESPRAALGPSGPVATFTDKVEARMLRFWP
The query sequence (length=353) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3c25:A | 354 | 353 | 1.0000 | 0.9972 | 1.0000 | 0.0 | 3bvq:A, 3bvq:B, 3c25:B |
2 | 5bxa:A | 414 | 32 | 0.0425 | 0.0362 | 0.4688 | 0.51 | |
3 | 5y28:A | 268 | 51 | 0.0453 | 0.0597 | 0.3137 | 0.78 | 5y2d:A |
4 | 2xyk:B | 130 | 36 | 0.0397 | 0.1077 | 0.3889 | 3.2 | 2xyk:A |
5 | 5ko6:A | 285 | 92 | 0.0680 | 0.0842 | 0.2609 | 4.9 | 6awe:A, 6axa:A, 6b2l:A, 6b37:A, 6b3l:A, 6b4q:A, 6b4t:A, 6b56:A, 6b6k:A, 6b71:A, 6b7i:A, 6bb7:A, 6bfv:A, 6bhb:A, 6bi1:A, 6bi9:A, 6bif:A, 6bj6:A, 6bj7:A, 5ko5:A, 5tbs:A, 5tbt:A, 5tbu:A, 5tbv:A |
6 | 7dwx:A | 605 | 58 | 0.0538 | 0.0314 | 0.3276 | 5.0 | 7dwx:C, 8i92:B, 8i92:D, 8i93:B, 8i93:D, 6m17:A, 6m17:C, 8wby:A, 8wby:D, 8wbz:A, 8wbz:D |
7 | 7og0:B | 498 | 55 | 0.0453 | 0.0321 | 0.2909 | 6.4 | 7ofw:A, 7ofz:A, 7og0:A |
8 | 3fd5:B | 355 | 44 | 0.0397 | 0.0394 | 0.3182 | 7.2 | 3fd5:A, 3fd6:A, 3fd6:B |
9 | 7old:C | 813 | 60 | 0.0482 | 0.0209 | 0.2833 | 7.6 | |
10 | 3a1n:A | 315 | 39 | 0.0397 | 0.0444 | 0.3590 | 7.9 | 3a1n:B, 3a4v:A, 3a4v:B, 3a9w:A, 3a9w:B, 3ajr:A, 3ajr:B |
11 | 4nh0:A | 861 | 62 | 0.0482 | 0.0197 | 0.2742 | 8.0 | 4n1a:A, 4n1a:B, 4n1a:C, 4n1a:E, 4nh0:B |
12 | 5bwe:B | 69 | 26 | 0.0312 | 0.1594 | 0.4231 | 8.8 | 5bwe:F, 4pkf:B |